SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012883 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012883
Domain Number 1 Region: 365-510
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.19e-28
Family Reductases 0.0081
Further Details:      
 
Domain Number 2 Region: 29-109
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 2.36e-28
Family Cytochrome b5 0.0033
Further Details:      
 
Domain Number 3 Region: 260-375
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.63e-22
Family Ferredoxin reductase FAD-binding domain-like 0.00099
Further Details:      
 
Domain Number 4 Region: 161-248
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0000000000174
Family GS domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012883   Gene: ENSTGUG00000012515   Transcript: ENSTGUT00000013031
Sequence length 513
Comment pep:novel chromosome:taeGut3.2.4:3:79860136:79886546:-1 gene:ENSTGUG00000012515 transcript:ENSTGUT00000013031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVPLKPGRSLMDWIRLTKSGKDLTGLKGRLIEVTEDELSKHNRKEDCWICIRGFVYNVTP
YMEYHPGGEDELMKAAGTDGTDLFDQVHRWVNYESMLKECLVGRMAVKPVAAPKGEFLHV
LIFLHQIPEDEIVSYLKTFIILVVFSKLLSLNLVFEIVNNIYDWFQTDSLITIVIYTKQK
DMNADLVIVDCQDKQLRGEIIMDDHSYLIEVDLDHAVSEDVAVNIAEKVGKVEIILNKKD
KVHWKMLGQPCEGHNTFIKRTDRGLFYRKCKLISKTEVTYDTKLFCLMLPKGTHLRVPTG
QHVYLKHIIAGTEVVKPYTPVLPFLPLDFQEPPCHDGVHIYLMIKIYSDGLFTQALDHLQ
IGDYISVSNPEGNFKKSQVQTSEDLLLLAGGTGFTPMVKLLNFALTEVSCLRTVKLIFFN
KTEHDILWRNQLEQLALKDERFEVQFVLSQPSKDWVGKQGKISLSLLSEFVKRTRRDSKV
LICICGPVPFTEQGVQYLKDLGYSQEEIHAFTA
Download sequence
Identical sequences H0ZQJ4
59729.ENSTGUP00000012883 ENSTGUP00000012883 ENSTGUP00000012883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]