SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013205 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013205
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.99e-81
Family Calponin-homology domain, CH-domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 4433-4592
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-29
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 240-356
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-28
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 4259-4375
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 4675-4810
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-26
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 2461-2622
Classification Level Classification E-value
Superfamily Spectrin repeat 1.6e-25
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 3232-3388
Classification Level Classification E-value
Superfamily Spectrin repeat 3.86e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 3774-3933
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-25
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 4015-4154
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-22
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 10 Region: 2793-2948
Classification Level Classification E-value
Superfamily Spectrin repeat 1.95e-21
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 11 Region: 1995-2153
Classification Level Classification E-value
Superfamily Spectrin repeat 3.76e-21
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 4804-4920
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 13 Region: 5140-5219
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.76e-20
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 14 Region: 3384-3499
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 15 Region: 4589-4709
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-19
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 16 Region: 1221-1341,1368-1392
Classification Level Classification E-value
Superfamily Spectrin repeat 9.1e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 17 Region: 4155-4266
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 18 Region: 674-776
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-16
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 19 Region: 3007-3167
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-16
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 20 Region: 3667-3790
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 21 Region: 5051-5131
Classification Level Classification E-value
Superfamily EF-hand 8.32e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 22 Region: 2683-2806
Classification Level Classification E-value
Superfamily Spectrin repeat 8.8e-16
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 23 Region: 3559-3680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000553
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 24 Region: 1765-1887
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000352
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 25 Region: 2371-2477
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000129
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 26 Region: 3931-4044
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 27 Region: 1903-2008
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000129
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 28 Region: 581-672
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000353
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 29 Region: 742-856,977-997
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000374
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 30 Region: 2228-2332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000918
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 31 Region: 4930-4991
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000835
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 32 Region: 2122-2222
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000275
Family Spectrin repeat 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013205
Domain Number - Region: 1530-1643
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00389
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number - Region: 996-1144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0106
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013205   Gene: ENSTGUG00000012802   Transcript: ENSTGUT00000013355
Sequence length 5434
Comment pep:known chromosome:taeGut3.2.4:3:89287560:89487676:1 gene:ENSTGUG00000012802 transcript:ENSTGUT00000013355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKKRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESED
MSAKERLLLWSQQTTEGYAGIRCENFTTCWRDGRLFNAIIHKYRQPLPDLIDMNTVAVQS
NLANLEHAFFVAEKLGVARLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGISAN
DVEVKWVEYQNMVNYLMQWIRHHVAIMSDRTFPNNPVELKALYNQYLQFKETEIPPKETD
KSKIKHLYKLLEVWIEFGRIKLSQGYHPNDIEKEWGKLIIAMLEREKTLRPEVERLEMLQ
QIANRIQRDSRSCEDKLILARNALQSDTKRLESGLQFQHEAEIAGYLLESENLLRQQVID
AQILIDGKYYQADQLVQRVAKLRDDLMAIRTECSSVYNKGHGLTTEQTKLMISGITESLN
SGFTTNLTPELNAAMTQGLTPTLTSSSLTSGLSSGLTSRLTPTITPAYPSGIPPRLIQSY
VTGVDSGTLQTLKLMQIRKPLMKSAFVDQNLTEEEVNMKFVQDLLSWVEEMQVQLDRAEW
GSDLPSVESHLENHKNVHKAIEEFESSLKEAKMSEIQMTAPLKLTYAEKLHKLESLYSKL
LNTSRNQERHLDTLHNFVSRATRELIWLNEKEEEEVAYDWSERNPNITRKKEYHAELMRE
LDEKEEVIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCHCVEQHLRENAAY
FEFFSDAKEAMEYLKNLKDTIYRKYSCDRSSSLHRLEDLVQESMEEKEQLLQYKSTVAGL
VGRAKAIIQLKPRNPDCVLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISP
SGNEAMVPSVCFTVPPPNKEAIDTANRIEQQFQNVLALWHESHVNMKSVVSWHYLTNEIE
VVRSGNVASIKTMLPGEHQQVLSNLQSRFDDFVEDSQESKIFTSSDTAQLEREVNVCKQY
YQELLKSAEREEQEESIYNLYISEVRNIRLRLESCEERLIRQIRTPMERDDVHENVLRIS
EQEKLKKELDRLKDDLGVITDKCEEFFSQAAGSPSVPTLRSELNVVIQNMNQVYSMSSIF
IDKLKTINLVLTNTQTAESLVKHYETKLCEEEAVTADKNNIENLMGTLKQWRSEVDEKRQ
TFHALEDELQKAKMISDQMFKMHKERDLDFDWHKEKVDQLAERWQNVHSQIENRLRDLEG
INKSLKYYKDTYNSLDTWIQQVEDTQRKIQEIQPENSKALAKQLNQHKMLVSEIEMKQSK
IDECQKYSEQYSAAVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSSDFIIQEFMDLRTRY
TALVTLMTQYIKFAGDSLKRLEEEEKSMEEEKKEHVEKAGDLLKWVSNLSKTLSKEEGEK
AEKTDLPKQQVSLHEMSTKKEQIAEALQTTQSFLAKHSDKMTDEERHEMEKQVRSLQESY
SLLSNEALKQLQEAHLGDEKMEEKDVAERQQECKEKLQEICDLLTQTENRLIGQRQSLVI
GDSKAELEQYQTKQEEIQKDMRTSAQTLAEIVKNTETFLKENGEKLSQEDKTILEQKLNE
AKTKCLLLSQKAEESKKELDKAMTTAIKQETEKVAAIEQLEESKNTIENLLDWLSNVDKE
AEHGWKFKQVIEQNGTHFEEGDMKVLEGEEDDVNGNLLEMQQDIETEVDGLVKSIDDNLN
QQYQKVKAQHEKIISQQQAIIVATQSAQALLEKQGHYLTPEEKDKMQRNMKELKAQYETA
LAESERKMKLTHSLREELEKFDADYSEFETWLQQAEQELDNLEAGASDFSGIMVKLKRQK
SFSEDVISHKGDLRYITISGQRVLDAARSCSKRDDGIDTSATYAEVQNKLDRASDRFKSL
YTKCSILGNNLKDLVDKYQHYEDASSGLLSGLQASEIAVNKQLSEPIAVDPKNLQRQLEE
TKVLQGQVSNHQIAVEKLKKAAEVLLDTRGELTPDKDEIRKTLDDIVERYDNLSKSVNER
NEKLQVTLTRSLSVQDGLDEMLDWMEGVEKSLKEQDQVPLNSAAIQDIISKSIMLEQDIS
GRQSSINTMNEKVKKFMETADPSTASTLQAKMSELAGRFSEASNKHREKLMKMEELKTKV
ELFEGLSTKLQSFLDEKNQALSETEAPRKDVSEVSQYMQEASVELAQHKKDLEVLKQLLE
ELSFHALPGDKALVSEKVNALSKKFKEVENTIKEKEEDVSSCQKQMDAFELLVESLKKWI
KETTERIPAAQPSLNTEELKKPLEDTLNLKDEWTLKAPELQKMNSRGTLLCNLITAVTSP
AKLRAVAKSGGTILNGEGGAPGTQDFLKNKELTTVQQAMSNVNHGYEDLGVLLNEKISEL
ESMLSKMQNIQEESTSMMHWLQKMDKTASDWEAAPTDSEAVKAQVEQHKLFETELKQSAN
KVQELKDKVTELLEKNPNSPEAPKWRQTLDKIDSKWKELNQVTSERQQKLEESSNYLIQF
QTAEAQLKHWLVEKELMVSVLGPLSIDPNMLNTQKQQVQILLKEFDTRKPQYEQLTMAGQ
GILERPGEHPPSHEIVKEQLAAVAQKWDSLTSQLKKRCDRIDQAIVKSTEYQSLLRSLSD
KLSALDSKLSSSLAVSTQPDAVKQQLEIAKEMKEQIELEMKNISAAQALCEELSALVGEE
YLKAELTRQLDGILKSFKDIEQKSDNHVQQLQSAYATSHQFQQMSKDFEAWLSKKKEELN
QARPVSAKLDALQSLIEEQKDFKKTMTDQISSYERIVAEGESILQKTQGDDRAELQSQIA
TLKSKWDEMNKQVKEREDKLADCLEKALKYKQHVENLQPWIEKCQRNLYELKVGINPVEI
EDSIVQVRAWQKDLDKHHGMVELLNNSAESLLNASQTDKEIIQEETKVLNQNVKVVTEQL
QKKRECLENMAQRVKEFQDSSRETERQLKSAKEHLEAHDSLGPQSFSNKHLTMMQAQQKA
LQALKPHVDLAKKLAQDLVVEASDSAGVSDLLLQAESLEQEYAAVKQQVEDRCSFLETKL
QGIGHFQNSIREMFSQFAEFDDELDSMAPVGRDLKVLQSQKEDIKCFMKKLEDLIMNNEN
ANKNCKIMLATEAEASPDLVGIKRDLEALNKQCNKLLDRAKAREDQVDGTICRVEEFYTK
LKEFSTLLGRAEEHEESQGPVGMETEAINQQLNTFKVFQKEEIEPLQVKQQEVNWLGQGL
IQSAAKSTNTENLERDLEDVNTRWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWLI
DTEDLVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKPTVEAIKREGEKIAESAEPADRV
KILKQLSFLDSRWDALLSKAETRNRQLEGISVVAQQFHEALEPLVEWLTTTEKRLANAEP
IGTQASKLQQQISQHKALEDDVLAHNKSLHQAISAGQSLKTMSSREDKDMVQEKLDSAQA
RYIEIQEKSNSRSELLRQAFSNAQIFGEDEVELMNWLNEIHDKLNKLSVQDCNREFLEKQ
HSELLDLQEEILLRKQNVDLAIQNGLELLKQTTGDEVVIVQDKLEGIKARYNDITKLSSD
VSKTLEQALKLAGQLHSTHEELCKWLDEVEMELLSYETQIPKGEELSQVQERQKELKKEA
KNNKGLVDTLNEVGSAFLELVPWRAREGLDKMITEDNERYRLVSDTISQKVDEIDAAFLR
SQQFDQAADAEFAWIAETEKKLMSLGDIRLEQDQTTAQLQVQKAFTMEILRHKDTIDELV
KSGDKIMKTCTEEEKHTMKKKIESLLQKYDQVCQMNSERNLQLERAQSLVNQFWETYEEL
WPWLTETEMIISQLPAPALEYETLKQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSP
GEGFSIQEKYVAADTLYSKIKEDVKKRALALDEAISQCTQFHDKIDPTLESLKRIVERLR
QPPSISAEVEKIKEQISENKNVSVDLEKLQPVYETLKQRGEEMIARSEGADKDMSAKAVQ
DKLDQMVLIWEDIQTLTEEREAKLLDVMELAEKFWCDHMALVATIKDTQDFIRELEGPGV
DPSVVKQQQEAAEAAKEEIDGLQEELEAVVSLGSELRTACGEPDKPIVNKSIDELNSAWD
ALNKTWKERVDKLGEAMQAAVQYQDGLQALFDWVDIAGSKLASMSPVGTDLETVKQQTEE
LKQFKTEAYQQQIEMERLNHQAELLLKKATQESDKHTVQDPLSELRLLWDSLEDKIISRQ
HKLEGALLALGQFQHALDELLAWLTHTEDLLNEQKPVGGDPKAIEIELAKHHVLQNDVFA
HQSTVEAVKKAGNDLIESSAVEEASNLRSKLELLNQRWQNLLEKTEQRKQQLDSALIQAQ
GFHGEVEDLQQWLTDTERQLLASKPVGGLPETAREQLNAHMELCAAFEAKEETYKCLMQK
GQQMLARCPESAETNVEQDINNLKEKWESVQTKLSERKTKLEEALNLAMEFHNSLQDFIN
WLTQAEQTLTAASRPSLILDTVLFQIDEHKVFATEVNSHRDQVIELDKTGTHLKYFSQKQ
DVVLIKNLLISVQSRWEKVVQRLVERGRALDDARKRAKQFHEAWHKLMEWLEESEKSLDS
DLEIANDPDKIKMQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTTLADDNLKLDDMLS
ELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYKIEPQLAEDQPVHGDIDL
VMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCAL
SVSKQTRLEQALRQAEEFHSVVHVLLEWLAEAEQALRFHGILPDDEEALRTLIEQHREFM
KKLEEKKAELNKATGMGEAILAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLAGA
LAGLIANQELLEALLSWLQWAETTLTEKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPD
VDKVTKTYKRKALEPSPVQSHIPVLDKGRAGRKRSPTPGIYPSAAQAQIETKNPRVNLLL
REFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRL
EMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPLTDADKIEDEVTRQVAKCKCAKRFQ
VEQIGDNKYRVSFVTQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHG
SKMLRSESNSSITTQPTIAKGRTNVELREKFILADGASQSMAAFRPRGRRSRPSSRGASP
NRSTSLSSQAGQAAAPQAVTTSTPKGTPIQGSKLRLPGYLSGKGFHSGEDSGILSTAATR
VRAQFADTRRTPSRPGSRAGSKAGSRSSSRRGSDASDFDISEIQSVCSDMSETVPATSRP
TPRAGSRPGSAKPSKIPTPQRRPLASKSDKSLKR
Download sequence
Identical sequences H0ZRG2
ENSTGUP00000013205 59729.ENSTGUP00000013205 ENSTGUP00000013205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]