SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013341 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013341
Domain Number 1 Region: 2-117,149-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-70
Family Calponin-homology domain, CH-domain 0.0000457
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013341
Domain Number - Region: 330-447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00432
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 269-361
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0482
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013341   Gene: ENSTGUG00000012955   Transcript: ENSTGUT00000013493
Sequence length 493
Comment pep:novel chromosome:taeGut3.2.4:5:55095610:55106371:-1 gene:ENSTGUG00000012955 transcript:ENSTGUT00000013493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QREFTQKKTFTSWINSILAKHTPPYVVSDLYTDIQQGHLLLDVLEVLSGQHLPREKGFNT
FQCRSNIENALTFLKSRSLKLINIHVADIIEGKPSIVLGLIWTIIFHFHIEELARTLACT
YNQPSPDCPSAVDSSPKANRSAKKSAKIKERWKMSATKALLLWAKEQCSLHGSVSVTDFK
SSWRSGLAFLAIIQTLRPGLVDLEKAKARSNKENLREAFRIAELELNIPRLLEPEDVDTV
NPDEKSIMTYVAQFLQYSKNLPESEEDMQEKVREAVGWLAEQEKKLAKLLVETEDETYCQ
KYKEMMSFMETFNQEKIPFLPVLSSKRGEAELSEGQQQMREEWDKVISQMNEWKVKLDQM
LPSPLGSIEAWLQEVERLQAEDLPDLQDPFKAMSVFREIIVIFKGLMECFDSHLDTLQSF
KNEDEKNMPLVLPEKLEEMKRRFGNIRSTNPSTFLEYHYGLCSAIANEVKLKLNIWDVKY
GAKESVESLLENW
Download sequence
Identical sequences H0ZRU7
ENSTGUP00000013341 ENSTGUP00000013341 59729.ENSTGUP00000013341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]