SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013656 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013656
Domain Number 1 Region: 8-154
Classification Level Classification E-value
Superfamily PR-1-like 2.62e-53
Family PR-1-like 0.00000222
Further Details:      
 
Domain Number 2 Region: 163-217
Classification Level Classification E-value
Superfamily Crisp domain-like 9.94e-17
Family Crisp domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013656   Gene: ENSTGUG00000013263   Transcript: ENSTGUT00000013812
Sequence length 218
Comment pep:novel chromosome:taeGut3.2.4:3:109467618:109502859:-1 gene:ENSTGUG00000013263 transcript:ENSTGUT00000013812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALSALSSSRAEQQKLIVDRHNALRRGVKPTASNMMKMEWCPAAAENAQNWANQCTLSHSP
PHLRRTNVLCGENLFMSSAPFSWSDVLQAWYNEEKNFEYGTGAKKKGAMFGHYTQLIWYN
SYKVGCGVSYCPAGPYKYFYVCQYCPAGNNPMQIAMPYRSGPKCADCPGHCDKGLCTNPC
KYQDLLGNCKNLQMLFGCSHSLVKKKCPASCKCTTQIL
Download sequence
Identical sequences H0ZSR0
59729.ENSTGUP00000013656 ENSTGUP00000013656 ENSTGUP00000013656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]