SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013937 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013937
Domain Number 1 Region: 138-549
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.38e-87
Family Amylase, catalytic domain 0.0000689
Further Details:      
 
Domain Number 2 Region: 552-648
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.37e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 
Domain Number 3 Region: 22-133
Classification Level Classification E-value
Superfamily E set domains 1.12e-19
Family E-set domains of sugar-utilizing enzymes 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013937   Gene: ENSTGUG00000013536   Transcript: ENSTGUT00000014096
Sequence length 654
Comment pep:novel chromosome:taeGut3.2.4:1:105820640:105934310:1 gene:ENSTGUG00000013536 transcript:ENSTGUT00000014096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYSLFYNRLKNIEESEGGLDKFTKSYKTFGVNQLADGGIYCKEWAPGAEAVFLAGDFNGW
NPSSHPYKKLEYGKWELFIPPEDGHSPVPHGSKLKVVIRAQNGALLYRISPWARYVVRDE
DKVNYDWVHWNPPQSYIHKNPSPKRLKSLRIYESHVGIASPEGKVASYKNFTYNVLPRIK
DLGYNCVQLMAIMEHAYYASFGYQVTSFFAASSRYGTPDDLKEMIDVAHSMGITVLLDVV
HSHASKNSEDGLNQFDGTDSCFFHSGYRGNHQLWDSRLFDYANWEVLRFLLSNLRMWIED
YRFDGFRFDGVTSMLYHHHGIGTGFSGDYNEYFGLHVDEDALCYLMLANHMINTLHPECI
TIAEDVSGMPALCRPVAEGGGGFDYRLAMAIPDKWIQIIKELKDEDWNMGNIVHTLTNRR
CEEKYIAYAESHDQALVGDKTLAFRLMDAEMYTNMSVLMPLTPVIDRGIQLHKMIRLITH
ALGGESYLNFMGNEFGHPEWLDFPRIGNNESYHYARRQFNLTEDDLLRYKFLNAFDRDMN
KLEERYGWLASPQAYVSEKHESNKVIAFERAGLIFIFNFHPYQSYVDYRVGSKIAFKYKI
LLDSDAGEYGGHQRLDHNTEYFSEEYPHNYRPNSIMVYIPSRVALVLHTMDIPK
Download sequence
Identical sequences H0ZTJ1
ENSTGUP00000013937 ENSTGUP00000013937 59729.ENSTGUP00000013937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]