SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013997 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013997
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.12e-46
Family Calponin-homology domain, CH-domain 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013997   Gene: ENSTGUG00000013594   Transcript: ENSTGUT00000014156
Sequence length 199
Comment pep:known chromosome:taeGut3.2.4:1:114245280:114254460:-1 gene:ENSTGUG00000013594 transcript:ENSTGUT00000014156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPSYGLSREVQEKIEQKYDAELESRLVNWIIVQCGEQIEHPPPGRQHFQTWLMDGT
LLCKLINSLHPKGNEPIAKISESKMAFKQMEQISQFLKAAEIYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSLAVTKDDGCYKGDPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQSGMTGYGMPRQII
Download sequence
Identical sequences A0A218UJQ2 B5FZX6
ENSTGUP00000013997 59729.ENSTGUP00000013997 ENSTGUP00000013997 XP_005420574.1.5688 XP_005420575.1.5688 XP_005492621.1.73095 XP_005492622.1.73095 XP_005492623.1.73095 XP_009093726.1.15306 XP_009093727.1.15306 XP_009093728.1.15306 XP_012425513.1.42559 XP_018775768.1.15306 XP_018775769.1.15306 XP_018775770.1.15306 XP_018775771.1.15306 XP_021391053.1.53032 XP_021391054.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]