SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014352 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014352
Domain Number 1 Region: 38-210
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.22e-30
Family Eukaryotic proteases 0.0018
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000771
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014352   Gene: ENSTGUG00000013948   Transcript: ENSTGUT00000014529
Sequence length 211
Comment pep:novel chromosome:taeGut3.2.4:Un:30524399:30528451:1 gene:ENSTGUG00000013948 transcript:ENSTGUT00000014529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VADCKAPPELEHGFVTFSTRNNLTTYQAAIQYHCQHPYYHMAPNSTATYTCDALGQWRSE
ELGTKLPSCRPVCGRPARPLPGIIKRIIGGRNAEPGFFPWQALIVVEDMSRVPNDKWFGS
GALLSESWVLTAAHVLRSQRRDKTVIPVSKEHVTVYLALHDVRNKGSCHRTVERIILHES
LTSRLHHDIALVKLKRRDHGEYVMPVCLPSL
Download sequence
Identical sequences H0ZUQ5
ENSTGUP00000014352 59729.ENSTGUP00000014352 ENSTGUP00000014352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]