SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014397 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014397
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-41
Family C-type lectin domain 0.00000765
Further Details:      
 
Domain Number 2 Region: 130-190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014397   Gene: ENSTGUG00000014002   Transcript: ENSTGUT00000014577
Sequence length 190
Comment pep:novel chromosome:taeGut3.2.4:28_random:156032:157358:-1 gene:ENSTGUG00000014002 transcript:ENSTGUT00000014577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTEGCDHNWHKFQGHCYRYFSRRRSWEDAERDSRRRAGHLTSIHSQEEHAFINGFGHENT
WIGLNDRIVEQDFQWTDNTGLQYENWRENQPDNFFAGGEDCVVLVSHEIGKWNDVPCNYN
LPYICKKGTVLCGPPPEVPNAFPVGKKREKYNIHSSVRYQCREGFTQRHVPTIKCHSSGK
WDRPKILCTK
Download sequence
Identical sequences H0ZUV0
ENSTGUP00000014397 ENSTGUP00000014397 59729.ENSTGUP00000014397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]