SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014554 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014554
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily EF-hand 6.51e-26
Family Osteonectin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014554   Gene: ENSTGUG00000014167   Transcript: ENSTGUT00000014743
Sequence length 96
Comment pep:novel chromosome:taeGut3.2.4:Un:32232706:32233609:1 gene:ENSTGUG00000014167 transcript:ENSTGUT00000014743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTSILPICKDSLGWMFNKLDMNYDLLLDPSEISAIYLDKYEPCVKPLFNSCDSFKDGKLS
NNEWCYCFQKPGGLPCQNEMNRIQKLSRGKILFGKF
Download sequence
Identical sequences H0ZVA7
59729.ENSTGUP00000014554 ENSTGUP00000014554 ENSTGUP00000014554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]