SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014685 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014685
Domain Number 1 Region: 54-92
Classification Level Classification E-value
Superfamily ARM repeat 0.0000299
Family Diap1 N-terninal region-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014685   Gene: ENSTGUG00000014310   Transcript: ENSTGUT00000014887
Sequence length 95
Comment pep:novel chromosome:taeGut3.2.4:Un:146131563:146132705:-1 gene:ENSTGUG00000014310 transcript:ENSTGUT00000014887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDRITSFRKAAVKKEKPLIQHPIDSQPSISEIPHAQALVDERCMNLSEKEVMDLFEKMME
DMNLNEERKAPLRDKDLSTKREMVVQYISATAKSV
Download sequence
Identical sequences H0ZVN8
ENSTGUP00000014685 ENSTGUP00000014685 59729.ENSTGUP00000014685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]