SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014752 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014752
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-38
Family DBL homology domain (DH-domain) 0.00056
Further Details:      
 
Domain Number 2 Region: 114-167
Classification Level Classification E-value
Superfamily PH domain-like 0.000000138
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014752   Gene: ENSTGUG00000014369   Transcript: ENSTGUT00000014957
Sequence length 167
Comment pep:novel chromosome:taeGut3.2.4:Un:5754204:5757511:-1 gene:ENSTGUG00000014369 transcript:ENSTGUT00000014957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTTPRIGDILQKLAPFLKMYGEYVKNFDNAMELVKTWTERSPQFKFIIQDIQKEKVCGNL
TLQHHMLEPVQRIPRYEMLLKDYLRKLPQDSLDWKDAEKSLEIISTAASHSNSAIRKMEN
LKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFL
Download sequence
Identical sequences H0ZVV4
XP_002197553.1.42559 ENSTGUP00000014752 ENSTGUP00000014752 59729.ENSTGUP00000014752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]