SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014918 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014918
Domain Number 1 Region: 169-209
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000114
Family Cytochrome b5 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014918   Gene: ENSTGUG00000014549   Transcript: ENSTGUT00000015136
Sequence length 212
Comment pep:novel chromosome:taeGut3.2.4:Un:94868130:94870320:1 gene:ENSTGUG00000014549 transcript:ENSTGUT00000015136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQELYSKERSASLDLLLRFQRLLVSKLYPADCVGQVPNTYSPDLLGVGSLLKKYTALLC
THISDILPVATSIACTSHRHFAEVSFVVDGDLTGILLPELVVSIVLLLSKNAGLMQETGA
IPLLAGLLEHLDRFNHLAPGKERDDNEDLAWPGIMGSFFTGQSCRNNEEVTLIRKADLEN
HNKDGGFWTVIDGKVYDIKDFQTQSLTGSSIL
Download sequence
Identical sequences H0ZWB9
ENSTGUP00000014918 59729.ENSTGUP00000014918 ENSTGUP00000014918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]