SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015532 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015532
Domain Number 1 Region: 2-117,149-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.58e-70
Family Calponin-homology domain, CH-domain 0.0000457
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000015532
Domain Number - Region: 332-412
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00393
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015532   Gene: ENSTGUG00000015181   Transcript: ENSTGUT00000015796
Sequence length 443
Comment pep:novel chromosome:taeGut3.2.4:Un:11944341:11954196:1 gene:ENSTGUG00000015181 transcript:ENSTGUT00000015796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QREFTQKKTFTSWINSILAKHTPPYVVSDLYTDIQQGHLLLDVLEVLSGQHLPREKGFNT
FQCRSNIENALTFLKSRSLKLINIHVADIIEGKPSIVLGLIWTIIFHFHIEELARTLACT
YNQPSPDCPSAVDSSPKANRSAKKSAKIKERWKMSATKALLLWAKEQCSLHGSVSVTDFK
SSWRSGLAFLAIIQTLRPGLVDLEKAKVRSNKENLREAFRIAELELNIPRLLEPEDVDTV
NPDEKSIMTYVAQFLQYSKNLPESEEDMQEKVREAVGWLAEQEKKLAKLLVETEDETYCQ
KYKEMMSFMETFNQEKIPFLPVLSSKRGEAELSGGQQQMREEWDKVISQMNEWKVKLDQM
LPSPLGSIEAWLQEVERLQAEDLPDLQDPFKAMSVFREIIVIFKGLMECFDSHLDTLQSF
KNEDEKNMPLVLPEKLEEMKRRL
Download sequence
Identical sequences H0ZY30
ENSTGUP00000015532 ENSTGUP00000015532 59729.ENSTGUP00000015532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]