SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015534 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015534
Domain Number 1 Region: 27-86
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.05e-17
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015534   Gene: ENSTGUG00000015194   Transcript: ENSTGUT00000015799
Sequence length 87
Comment pep:novel chromosome:taeGut3.2.4:Un:11993003:11993546:1 gene:ENSTGUG00000015194 transcript:ENSTGUT00000015799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDFDLILENIKDLNSLVGEGIPQIVHTPRGARLGRPEPLPLTLYRNGIVVGHGAFRPYQH
PATQQCLQDIMDGYLPSELQPRYPDGV
Download sequence
Identical sequences H0ZY32
ENSTGUP00000015534 ENSTGUP00000015534 59729.ENSTGUP00000015534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]