SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015861 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015861
Domain Number 1 Region: 564-823
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.95e-68
Family Tandem AAA-ATPase domain 0.00008
Further Details:      
 
Domain Number 2 Region: 323-562
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.9e-53
Family Tandem AAA-ATPase domain 0.00011
Further Details:      
 
Domain Number 3 Region: 190-260
Classification Level Classification E-value
Superfamily BRK domain-like 2.88e-21
Family BRK domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015861   Gene: ENSTGUG00000015488   Transcript: ENSTGUT00000016141
Sequence length 849
Comment pep:novel chromosome:taeGut3.2.4:Un:73215460:73228394:1 gene:ENSTGUG00000015488 transcript:ENSTGUT00000016141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQE
YLNSILQHAKDFKEYHRSVSGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMVAL
RGGCVLLLDGGPALCPEFPIPILGGFLGLRIPNPGGIFGAEDSQSQSQSWGISGAENSQS
QSKSWGISGQPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPR
SDSEESGSEEEEEEEEEEQPQPAQPALPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVD
DEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQVGVELDAVWDEDLRWIL
RSEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGS
PAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVL
NTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLN
EEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVL
LTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYR
ASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGM
LLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQN
EVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQD
EVRSGAGSS
Download sequence
Identical sequences H0ZZ08
ENSTGUP00000015861 ENSTGUP00000015861 59729.ENSTGUP00000015861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]