SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016023 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016023
Domain Number 1 Region: 62-199
Classification Level Classification E-value
Superfamily EF-hand 7.77e-26
Family Calmodulin-like 0.0038
Further Details:      
 
Domain Number 2 Region: 5-69
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000806
Family Spectrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016023   Gene: ENSTGUG00000015702   Transcript: ENSTGUT00000016320
Sequence length 225
Comment pep:novel chromosome:taeGut3.2.4:17_random:19789:22419:-1 gene:ENSTGUG00000015702 transcript:ENSTGUT00000016320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHN
LEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEP
DPEFESILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKE
ELYQNLTREQADYCISHMKPYMDGKGRELPSAYDYIEFTRSLFVN
Download sequence
Identical sequences H0ZZG9
59729.ENSTGUP00000016023 ENSTGUP00000016023 ENSTGUP00000016023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]