SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016097 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016097
Domain Number 1 Region: 62-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-21
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 2 Region: 2-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000418
Family Complement control module/SCR domain 0.00052
Further Details:      
 
Domain Number 3 Region: 119-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016097   Gene: ENSTGUG00000015769   Transcript: ENSTGUT00000016395
Sequence length 179
Comment pep:novel chromosome:taeGut3.2.4:18_random:319292:322611:1 gene:ENSTGUG00000015769 transcript:ENSTGUT00000016395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCHRPPEVMFATLSVDKKVYEVGEEVEYTCRPGFMPNSGQRKYTCLPTGKWAFNTLLCLP
KRCPPPPPLQNGKMDFEEFQYQSTVTFSCDPGYNLVGSRTSQCMADGKWTGTVPQCQPVT
CAPPSLPEFGVLSFRRLNPGNVSHFLDTIQFECVPPLALIGNETATCTANGTWSSIPVC
Download sequence
Identical sequences H0ZZP3
59729.ENSTGUP00000016097 ENSTGUP00000016097 ENSTGUP00000016097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]