SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016172 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016172
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-34
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1966-2099
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000325
Family Extended AAA-ATPase domain 0.073
Further Details:      
 
Domain Number 3 Region: 1993-2028,2106-2222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000399
Family RecA protein-like (ATPase-domain) 0.089
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016172
Domain Number - Region: 1776-1804
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0445
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016172   Gene: ENSTGUG00000015800   Transcript: ENSTGUT00000016475
Sequence length 2329
Comment pep:known chromosome:taeGut3.2.4:5_random:391481:541424:1 gene:ENSTGUG00000015800 transcript:ENSTGUT00000016475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAEIIEVVANEKIEDINGCPKNRSQMIE
NIDACLSFLAAKGINIQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQQPQHHPAQQAGPP
SQCQLGIPQQQVPNPLHTPCQQPAQAVQHQFKAQPEMQSRLPGPTMRVSAAGSEAKARGS
ISANNRRSQSFNNYDKSKPGLLPPTPTGSTDKEPADSTASQPTGMNENVSSSAPSCGSAV
PCNNSSAIPQPSSAIKPWRSKSLSAKHTATSSMLSVKQPAVEPPKPPSEIAKTAPNGQKS
MLEKLKLFNSKGGSKAACPGSRDNSCEKLEVLLSFEESEEIDAANQNVNNPGSMSSSPKI
ALKGIAQRTFSRALTNKKSSPKGNEKEKEKQKEKEKDKSKDITKRTSITEKLELKAEPKE
EQTALTTATEMPKKSSKIASFIPKGGKLNSAKKEASAPSHSGIPKPGMKNTAGKSSSGPV
AAKEGERSRGGKGSSGLSHQKSQLDSRHSSSSSSLASSEGKGAGGLPGSSSSQAVSGPAA
ATHSTGSNTASVQLPHPQQQHSHPNTATVAPFMYRSQTDNEGNVTAEASTGGVSMDSALY
VKTAQPALEDLSGEDPETRRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNVT
TEISGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSTGSGYPPRGNASRFVSAEPGTARY
LYSAPLRRQLATRGGSVCHVDIADKAGDDIDLEGIAMDATGYMSDGDVLGKNIRADDITS
GYLTDGGLGLYTRRLNRLPEGMATVRETLQRGTALRLGDADSWDDSSSVSSGISDTIDNL
STDDINTSSSISSYANTPASSRKNLDAQTDAEKHSQVERNSLWSSDEVKKSDGGSDSGIK
MEPGSKWRRNPSDVSDESDKSTSGRKNTVISQTGSWRRGMSAQVGITTPRPKPSTTSGTL
KTPGTGKTDDAKVSEKGRLSPKAGHVKRSPSDAGRSSGDESKKLPTSNSRTAAANANTFG
FKKQSGSAIGMTIITASGATLTSRSATLGKIPKSSGLMGRTTGRKTSVDGSQNQDDGYLA
LSARTNLQYRSLPRPSKSSSRSGAGNRSSTSSIDSNISSKSAGLLVPKIREPAKVILGSS
LPGLVNQTDKEKGISSDNESVASCNSVKVNPASQPAASGAQSTHQQGVKYPDVASPTLRR
LFGGKPSKQVPITTAENMKNSVVISNPHATMNQQGNLDSPSGSGVLSSGGSSPLYGKNTD
LNQSPLASSPSSAHSAPSNSLTWGTNASSSSAVSKDGMGYQSVSSLHTSCESIDISLSSG
GGLSHNSSSGLIPASRDDSLTPFVRTNSVKTTLSESPLSSPAASPKFCRNTLPRRQDSDP
HLDRNTLPKKGLRYTPSSQLRSQEDAKEWLRSHSAGGLQDTAANSPFSSGSSITSPSGTR
FNFSQLASPTSAAQMSLSNPSMLRTHSLSNADAPYEPCGDARLRNSSVSLDEKSRTMSRS
GSFRDGFEEVHGSSLSLVSSTSSIYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTAN
AHLVAAFEQSLGNMTIRLQSLTMTAEQKASFKRIWKKTIELLKKQNAAAQAAINGVINTP
ELNCKGPGAAQPAELRIRRQHSSDSVSSINSATSHSSVGSNIESDSKKKKRKNWVSYLRS
SFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHHNTAVSTPLLRTSHSNSLISECA
DSEAETVLQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLK
SENHGSCSRAQSQVSISSSPRHSVGLSQHSLNLTESTSLDMLLDDTGDGSARKERGRHVI
IVNFQDEMKWKEDSRPRTFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNS
DSVLGYSIGEIRRTNSAETPELLPCGYLVGENNTISVTIKGICENSLDGLAFESLIPKAI
LQRYVSLLMEHRRIILSGPSGTGKTYLANRLSECMVLREGRELAEGIIATFNVDHKSSKE
LRQYLSNLADQCNSENNAVDMPLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQ
ATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLIETEISGRMRNAELVKIIDWIP
KVWQHLNKFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQ
LYGRRAPWEDPAKWVMDTYPWAASPQHHEWPPLLQLRPEDVGFDGYSVSREGSTSKQVPV
SDAEGDPLMNMLMRLQEAANYSSPQSYDSDSNSNSHHDDILDSSLESTL
Download sequence
Identical sequences H0ZZW8
ENSTGUP00000016172 59729.ENSTGUP00000016172 ENSTGUP00000016172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]