SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016219 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016219
Domain Number 1 Region: 3-96
Classification Level Classification E-value
Superfamily PR-1-like 8.5e-27
Family PR-1-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016219   Gene: ENSTGUG00000015897   Transcript: ENSTGUT00000016525
Sequence length 117
Comment pep:novel chromosome:taeGut3.2.4:Un:74869734:74871493:-1 gene:ENSTGUG00000015897 transcript:ENSTGUT00000016525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYRSPAFHVQSWYDEVKDYTFPYPHECNPWCPERCTGAMCTHYTQIVWATTNRIGCAVHV
CKQMNVWGEIWENAVYLVCNYSPKGNWIGEAPYKTGRPCSECPPSYGGSCQNNLCYK
Download sequence
Identical sequences H1A015
ENSTGUP00000016219 ENSTGUP00000016219 59729.ENSTGUP00000016219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]