SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016237 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016237
Domain Number 1 Region: 128-235
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-20
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 2 Region: 241-305
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 300-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000681
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 63-128
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000027
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 368-427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000136
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016237
Domain Number - Region: 2-58
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0111
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016237   Gene: ENSTGUG00000015889   Transcript: ENSTGUT00000016546
Sequence length 516
Comment pep:novel chromosome:taeGut3.2.4:19_random:101482:103874:-1 gene:ENSTGUG00000015889 transcript:ENSTGUT00000016546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLIIRNGNNVEAPPVYDSYEVEYLPIEGLLSTGRHFFVELTTDSSGAAAGMALRYEAFEQ
GHCYEPFVKYGNFTTSDPRYPVGTTVEFSCDPGYTLEQGSTIIECVDPSDPQWNETEPAC
RAVCSGELTDTAGVVLSPNWPEAYGKGQDCIWGLHVEEDKRIMLDVRVLRLGSGDMLTFY
DGDDLTARILGQYTGARGRFKLYASTADVTVQFQSDPGAGAFAYRQGFVIHFSEVPRNDT
CPELPDIANGWKTSSQPELLHGTVVTFHCYPGFQLTGTDLLMCHWDLTWSGDLPSCERVT
TCRDPGDAEHSRRVVSNPKFPVGATVQYVCDKGYVLAGAGTLTCHDRAAGGPKWSDRLPK
CIPETYEPCHNPGVPAGGRQSPERRLYPAGATLHFSCTAGRALLGESSLRCLPGHPSRWS
GSPPICKAASYDEFYSNRNLDAVAKAVPSGTTLEGTNVAIAVFLPVLVVALLIGGIYLYF
SKLQGKPALQLPLAGSHPYDHITVESAFDNPTYETG
Download sequence
Identical sequences H1A033
ENSTGUP00000016237 ENSTGUP00000016237 59729.ENSTGUP00000016237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]