SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016418 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016418
Domain Number 1 Region: 390-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.15e-35
Family Calponin-homology domain, CH-domain 0.0000868
Further Details:      
 
Domain Number 2 Region: 88-244,389-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.1e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 982-1013
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000685
Family LIM domain 0.0093
Further Details:      
 
Domain Number 4 Region: 1014-1043
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000491
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016418   Gene: ENSTGUG00000016051   Transcript: ENSTGUT00000016740
Sequence length 1108
Comment pep:novel chromosome:taeGut3.2.4:5_random:1491116:1550694:-1 gene:ENSTGUG00000016051 transcript:ENSTGUT00000016740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQNMGENDDEKYNQAGQIFENFVQASTCKGTIQAFNILTRQLELDPLDNRNFYTKLKSRV
TTWKAKALWNKLDKRASHKEYKRGKSCMNTKCLIIGGGPCGLRTAIELAFLGAKVVVVEK
RDTFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALILGVEI
HVNLEFVKVLEPPEDQENQKMGWRAEFLPMDHPLSEYEFDVIIGADGRRNTLEGFRRKEF
RGKLAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDSTH
YFVMTAKKQSLLDKGVIINDSIDTELLLCGENVNQSNLLSYAREAADFATNYQLPSLDFA
INHYGQPDVAMFDFTSMYASENAALVRERHRHQLLVALVGDSLLEPFWPMGTGCARGFLA
AFDTAWMVRSWAQGKPPLEILAERESIYRLLPQTTPENINKNFDQYTIDPGTRYPNLNSS
CVRPHQVRQLYVTNELQQCPLERVSSIRRSVNLTRQESDIRPNKLLTWCQKQTEGYRNVN
VTDLTTSWKSGLALCAIIHRFRPDLIDFDALKEEDVVRNNQLAFDVAEQEFGIPPVTTGK
ELGSVGEPDKLSMVLYLSKFYELFRGTPLRAVNAAEKQNGENNDLGSPKSSNFIFNNYIN
LTLPRKRVPKVSWKTEENETNKRRRKGLFGVFEQVGTFKGTNNGKEQSDGREGMNQNKVK
SMATQLLAKFEENASNTILRRQKMRLTKGVGKDSLVSLSRLACTSCVGLIYFSACPQAPE
VHRVLFTSSVSRFQVVREPKQSLNGSDHMARRAKTVHKTDLQPSLSETSENLASACSAAF
VLSGVLERLQHLEEKMKQKRAQSIANREFHKKNIKEKAAHLASMFGYMEFPKNKLPTKGL
PHSQPPTPSCSPPHHSTVAASSSVGSASSAVSSQQTTVGKVSHAIGAVAEVLVNLYVNDH
RPKAQLELVRLNPQRNKFPKSIGGSDICYFCKKRVYVMERLSAEGHFFHRECFKCEICST
TLRLGIYAFDVEEGKFYCKPHFTHCRISTKHRKRRATIQIHGKVWNAWKKVEARHSEITT
ESSLSTASSPEDRSPVQFNIPVLHPLTG
Download sequence
Identical sequences H1A0K9
ENSTGUP00000016418 59729.ENSTGUP00000016418 ENSTGUP00000016418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]