SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017048 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017048
Domain Number 1 Region: 10-258
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-76
Family Protein kinases, catalytic subunit 0.000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017048   Gene: ENSTGUG00000016741   Transcript: ENSTGUT00000017413
Sequence length 258
Comment pep:novel chromosome:taeGut3.2.4:Un:137952262:137959202:-1 gene:ENSTGUG00000016741 transcript:ENSTGUT00000017413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNMENPKMKYTELEDIGKGTFGHVVRALNKATGEEVAIKKIILKGLKGKQVTVNEISIM
KRHRSPSVVNYLDSSLLGEELWLLMEYMDGGALSDVISKTCLCEGDIASISQECLQGLDF
LHSNHVIHQDVKSSNILFGADGSVKLADFGISVELGPEEKRPSSVARTPWWMAPEVLMRG
PYGPKVDIWSFGIVGIEMVEQNVPYWNQSPATTKHLRATAGTPQLRQPKLLSAWLRDFLS
CCLQRDEERRWSADELLQ
Download sequence
Identical sequences H1A2D6
ENSTGUP00000017048 59729.ENSTGUP00000017048 ENSTGUP00000017048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]