SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017058 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017058
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily CAD & PB1 domains 6.28e-35
Family CAD domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017058   Gene: ENSTGUG00000016766   Transcript: ENSTGUT00000017425
Sequence length 93
Comment pep:novel chromosome:taeGut3.2.4:Un:81679496:81679971:-1 gene:ENSTGUG00000016766 transcript:ENSTGUT00000017425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGAVTRQTLFPPLMPAGRPFRVSNASRSSRKGIVASSLQELLSKTLDAFFITAGIVTLVL
EEDGTVVDTEDFFKSLDDNTHFMVLENGQKWTP
Download sequence
Identical sequences H1A2E6
ENSTGUP00000017058 59729.ENSTGUP00000017058 ENSTGUP00000017058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]