SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017833 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000017833
Domain Number - Region: 133-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00546
Family Calponin-homology domain, CH-domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017833   Gene: ENSTGUG00000017552   Transcript: ENSTGUT00000018239
Sequence length 188
Comment pep:novel chromosome:taeGut3.2.4:Z_random:1219399:1219965:-1 gene:ENSTGUG00000017552 transcript:ENSTGUT00000018239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VATDVFNSKSLAIQAQKKILGKMVSKSIATTLIDDTSSDVLDELYRVTKEYTQNKKEAEK
IIKNLIKIVLKLAILYRNNQFNQDEIALMEKFKKKVHQLAKTVVSFHQVDYTFDRNFLSK
LLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGPYKIHLQKLCDGVN
KMLDEGNI
Download sequence
Identical sequences H1A4L7 U3KL34
ENSFALP00000015738 59729.ENSTGUP00000017833 ENSTGUP00000017833 ENSTGUP00000017833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]