SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|376254886|ref|YP_005143345.1| from Corynebacterium diphtheriae PW8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376254886|ref|YP_005143345.1|
Domain Number 1 Region: 5-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-20
Family DsbC/DsbG C-terminal domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|376254886|ref|YP_005143345.1|
Sequence length 206
Comment hypothetical protein CDPW8_1790 [Corynebacterium diphtheriae PW8]
Sequence
MANNVTFWFDVSCPFCWITSRWIKEVEKVRDISVTWVPMSLSVLNDGRDELPQDYKDKMK
ANWGPARVFAAVATEQPDRVDALYTAMGTRIHNQGEGGKQGYAAYDAIIADALEDVGLPA
SYAAVANTDTWDNALAAFHATAMDAVGNDVGTPVVKLGDTAFFGPVLTRIPRGEEAGILF
DASFQLAAYPHFFEIKRSRTESPQFD
Download sequence
Identical sequences WP_003852486.1.21794 WP_003852486.1.48478 WP_003852486.1.63803 WP_003852486.1.8291 gi|376254886|ref|YP_005143345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]