SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000470 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000470
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-58
Family Phosphotyrosine-binding domain (PTB) 0.000000258
Further Details:      
 
Domain Number 2 Region: 342-447
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-28
Family SH2 domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000470   Gene: ENSTGUG00000000448   Transcript: ENSTGUT00000000476
Sequence length 454
Comment pep:novel chromosome:taeGut3.2.4:Z:7306755:7358532:1 gene:ENSTGUG00000000448 transcript:ENSTGUT00000000476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSSEKILGPGVTYIVKYLGCIEVLRSMRSLDFSTRMQVAREAISRVCEAMPGAKRAFKKR
KPPSKVLSSILGKSNLQFAGMSIMLNISTSSLNLMNPDTKQIIANHHMQSISFASGGDPD
TSDYIAYVAKDPVNRRACHILECCDGLAQDVISTIGQAFELRFKQYMQCPSKTPTLSDRM
QSFEDPWTEEDNEAPEHPYYNNIPNKIPPPGGFLDARLKTRLPTAADTPQVRMGGEQIYY
QSHHLGEKFSEEWHHEHVKQGSLDICSMLEDKSETVPTGELPIYVNTQHINREDLLVLKA
DAENSPGKDLFDMKPFEDALKNQTSEALLKKSTSMGCTSPPLSRVAVQTEAEDLSTEPWY
QGEMSRKEAEQLLKKCGDFLVRKSTTNPGSYVLTGMHKGQAKHLLLVDPEGTVRTKDRVF
DSISHLINYHLENNLPIVSSVSELCLQQPAERKH
Download sequence
Identical sequences H0YQB5
59729.ENSTGUP00000000470 ENSTGUP00000000470 ENSTGUP00000000470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]