SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001240 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001240
Domain Number 1 Region: 18-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-46
Family Hypothetical protein AT3g04780/F7O18 27 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001240   Gene: ENSTGUG00000001201   Transcript: ENSTGUT00000001252
Sequence length 209
Comment pep:known chromosome:taeGut3.2.4:23:3619933:3621962:-1 gene:ENSTGUG00000001201 transcript:ENSTGUT00000001252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTGAAMAHGPGRCRCCGAEAAERGAAWGLYLRIDRQRLQCLNERREGSGATVFRPWEQRG
DRSQFVESDDDEELLFNIPFTGSVKLKGVIVMGEDGDSHPAEMRLFRNIPHMSFDDTAKE
PEQSFSLSRDPLGELEYPTKISRFSNVYHLSMHFPKNFGAETTKIFYIGLKGEWTEAHRH
EVTICNYEASANPADHKVEQITPQTHFIS
Download sequence
Identical sequences H0YSI0
ENSTGUP00000001240 59729.ENSTGUP00000001240 ENSTGUP00000001240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]