SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001346 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001346
Domain Number 1 Region: 309-405
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 460-746
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 6.93e-21
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.033
Further Details:      
 
Domain Number 3 Region: 42-110
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000832
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 4 Region: 232-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000436
Family I set domains 0.024
Further Details:      
 
Domain Number 5 Region: 154-228
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000349
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001346   Gene: ENSTGUG00000001305   Transcript: ENSTGUT00000001359
Sequence length 777
Comment pep:known chromosome:taeGut3.2.4:13:10580367:10781311:1 gene:ENSTGUG00000001305 transcript:ENSTGUT00000001359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVDQSRSLYSDVGRLHQEDSRRFEVTRQKALPGQDGPRAPCERSSCGRGSRCVLNRDTS
QPECRCVEDCKSSYMPVCGSDGRFYENHCQLHRASCLQRKKIYIIHSKDCFFKGDSCTMA
DYSRLKSILLDLQARRQSPPSSLAKDRGAQKRFLIEELFKHLDLNSDGHLSSSELAQPMK
KEGLEDDLLGCTLEDLLQFDDYNNDGRLTLQELYTAFQVIQLSLPEEQRVTVTTITVGLS
TVLTCGIRGALRPPIIWKRNGVVLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHAYG
YEELYQTHILQVNVPPVIRVYPETQAQEPGVSASLKCHAEGIPNPRITWLKNGIDIMPKL
SKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTRLSVGNMF
YVFSDDGITVLQPNECEIRRHIRPEERIFTSYEEICPRVEGEDTQSCLWASAVNVRDKYI
YVTQPKQNRVMIIDIQTQKAIQSLDVDPLPTKLHYDKSHDQVWVLSWGDMRKSSPTLQVI
PEASTGEDPHVIHTPFEGVEDFFIPPTNLIINHVRFGFIFNQSKHAVHKIDLETVTHIKT
IHLKAHSCVPQAMAYTHLGGYYFVQCRRSRSAAASPQLIIDSVTDAVIGPNGRVSGTPHV
SPDGRYLVSADRGSGSIRVQALTVRGEIKLIYDLKTNIHVSDLTFQPSFTEGNQYYIYAT
SHLQTDVLFVELSTGRMNVLKNLKDPITSKDWPWSSYNRIMKDSGLFGQYVGSPGTE
Download sequence
Identical sequences H0YST5
59729.ENSTGUP00000001346 ENSTGUP00000001346 ENSTGUP00000001346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]