SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002777 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002777
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Cupredoxins 5.66e-26
Family Ephrin ectodomain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002777   Gene: ENSTGUG00000002702   Transcript: ENSTGUT00000002805
Sequence length 163
Comment pep:known chromosome:taeGut3.2.4:4A:5764021:5807953:1 gene:ENSTGUG00000002702 transcript:ENSTGUT00000002805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKRQQDYFITSTSNGTLDGLENREGGV
CQTRSMKIVMKVGQDPNAVIPEQLTTSRPSKESDDTMKVVTQSPRSKVPAVEEPGKPGSV
NQDGQETQGPSDGFLSSKVAVFAAIGAGCVIFILIIIFLVVLL
Download sequence
Identical sequences H0YWV3
ENSTGUP00000002777 59729.ENSTGUP00000002777 ENSTGUP00000002777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]