SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003572 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000003572
Domain Number - Region: 309-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.032
Further Details:      
 
Domain Number - Region: 345-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003572   Gene: ENSTGUG00000003465   Transcript: ENSTGUT00000003609
Sequence length 403
Comment pep:novel chromosome:taeGut3.2.4:14:1445217:1453239:1 gene:ENSTGUG00000003465 transcript:ENSTGUT00000003609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPPLRPYPARQHGPRHGHRHVRDCQPVQYGNVTHQAWPGDNSTAGPVAVTRTFVSYIPP
EGSDRKVIYGHFTFVRNPLRTFSVLEPGGAGGCLAQRRAPVEETAKLRRCLVAQNGGYFN
METGECLGNVVSDGRLVRNSGGLQNAQFGIRKDGTMVFGYLSEEDVLDQSNPFVQLVSGV
VWLLRNGEVYINQSRVAECGDTQTTGTFDKFINVISARTAVGHDRQGRLVLVHVDGQTES
RGVNLWEMAEFLKQQGVINAINLDGGGSATLVLNGTLANYPSEHCSFDSMWRCPRSISTV
VCVHEPGCDPPDCSGHGLCVAGHCRCDSPFWAGPACDTLDCGPANCSLRGVCSAAGCLCD
AGWTGSNCTEECPPGWFGPSCQSRCECDHSCPCDPETGSCNIT
Download sequence
Identical sequences H0YZ39
ENSTGUP00000003572 ENSTGUP00000003572 59729.ENSTGUP00000003572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]