SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004492 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004492
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Homeodomain-like 2.1e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000618
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 63-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000235
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004492
Domain Number - Region: 161-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00134
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004492   Gene: ENSTGUG00000004361   Transcript: ENSTGUT00000004540
Sequence length 397
Comment pep:known chromosome:taeGut3.2.4:8:4783831:4796031:1 gene:ENSTGUG00000004361 transcript:ENSTGUT00000004540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVGCRAEENTCPFRPPAMLFHGISGGHIQGIMEEMERRSKTESRLAKGGQMNGRDTNM
PPMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLTTGDHFGMKDNL
VYCRAHFESLLQGEYPPQLSYTELAAKSGGLALPYFNGAGTVQKGRPRKRKSPALGVDIV
SYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTAT
TLTDLTNPTITVVTSVTSNLDSHESGSPSQTTLTNLF
Download sequence
Identical sequences H0Z1Q2
ENSTGUP00000004492 XP_012430549.1.42559 XP_021403106.1.53032 XP_021403114.1.53032 ENSTGUP00000004492 59729.ENSTGUP00000004492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]