SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005119 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005119
Domain Number 1 Region: 294-489
Classification Level Classification E-value
Superfamily MIR domain 4.05e-49
Family MIR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005119   Gene: ENSTGUG00000004939   Transcript: ENSTGUT00000005169
Sequence length 728
Comment pep:known chromosome:taeGut3.2.4:17:6910123:6922208:1 gene:ENSTGUG00000004939 transcript:ENSTGUT00000005169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGFLKEPVVVTAKINVSLVALTVMGLINRLWGLCYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRLLPALAGAFCVPLAY
QILVELHFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQKHS
AFSGSWWFWLLLTGVACSCAVGVKYMGLFTYMLLLATAGLHFWHMIGDQNLSNVSLLCHF
LARGLALVIIPMGLYLSFFYVHLALLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKASGLSGASLPEWGYRQLEVVGEKLS
KGYHQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNE
DTEHKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVATWASANAAALVYLCLSLWYLL
RRRRKIYDIPEDAWQLWMSAGGICGGGWAVNYLPFFLMEKTLFLYHYLPAVTFQILLIPV
VLQHLSDHLCRSVLLKSMFSALTVAWFSSVYFVYCTFSPVTYGQPALSLPQLKALRWKDT
WNILIRKQ
Download sequence
Identical sequences H0Z3H5
59729.ENSTGUP00000005119 ENSTGUP00000005119 ENSTGUP00000005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]