SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005168 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005168
Domain Number 1 Region: 42-111,233-333,416-451
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000141
Family Quinohemoprotein amine dehydrogenase B chain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005168   Gene: ENSTGUG00000005012   Transcript: ENSTGUT00000005219
Sequence length 478
Comment pep:known chromosome:taeGut3.2.4:8:7702678:7720355:1 gene:ENSTGUG00000005012 transcript:ENSTGUT00000005219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRITTSDTLTQISPKEGWQVYSSAQD
PDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQ
MKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNL
STVLTGIQEEIGAYDYEELHQRVVNLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGA
WMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
SLYFNKYQSNIIIKYSFDTGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVY
ATNQNAGNIVISQLNQDTLEVLKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY
STKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
Download sequence
Identical sequences H0Z3M4
ENSTGUP00000005168 59729.ENSTGUP00000005168 ENSTGUP00000005168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]