SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006260 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006260
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily MIR domain 1.16e-37
Family MIR domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006260   Gene: ENSTGUG00000006097   Transcript: ENSTGUT00000006323
Sequence length 145
Comment pep:known chromosome:taeGut3.2.4:19:7149171:7150968:-1 gene:ENSTGUG00000006097 transcript:ENSTGUT00000006323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSYWRVRGRTAAVCQRGTPVRCGQTIRLTHLGTGRNLHSHRFTSPLSGNQEVSAFGEAGE
GDYLDDWTVVCSGTYWVRDDEVRFQHTSTDVFLSVTGEQYGRPIHGQKEVHGMATSSQNN
YWKVMEGIFMQPSEAIQMEQYHAEL
Download sequence
Identical sequences H0Z6R1
ENSTGUP00000006260 59729.ENSTGUP00000006260 ENSTGUP00000006260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]