SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006666 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006666
Domain Number 1 Region: 238-364
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-30
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 368-468
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-25
Family Third domain of FERM 0.003
Further Details:      
 
Domain Number 3 Region: 149-200
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000661
Family Ras-binding domain, RBD 0.055
Further Details:      
 
Domain Number 4 Region: 20-80
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000772
Family PDZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006666   Gene: ENSTGUG00000006480   Transcript: ENSTGUT00000006732
Sequence length 1497
Comment pep:novel chromosome:taeGut3.2.4:4A:19485886:19521412:1 gene:ENSTGUG00000006480 transcript:ENSTGUT00000006732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHVMPEERGGDDMECGQLPSDTLRQVTVQRHPLYGFGFVAGSERPVVVRSVAAGGPSEDK
LLPRDQILAINDDDVSESPQIEEGTLCASRAGWVIYPVLSFQSPKSAFISAAKKAKLRSN
PAKVRFSEQVTVGETDPDMLKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQ
DRLSLRHIEHFALVLEYSSPEQSHRFLLLQDKQPLAHVVQRTHYHGMRCLFRVSFFPKDP
VELLRRDPAAFEYLYIQSRNDVIRERFGTDPKPEMLLGLAALHIYITVSATRPSQKVSLK
NVEKEWGLEPFLPPSLLQLIKEKSLRKSLSQQLKAHQHQPGGTKVSTAQAKLQYLRILNE
LPTFAGVLFNTVGLDEKQAATTLLVGPRHGISHVIDLKTNLTTVLSEFSKVSKIQLFREN
QGVARVETSILDAKPLVLLMEWPEATNFACLIAGYCRLLVDSKKMILSRAPSQPPPPQII
KADYINAHNFQRPATAGHVGKKENGLVGGSATVTGAAGASATRASDSELIRFCYLHMREQ
RKERESGTDINENLIFFEETRPRTKSDPTSKSSGQGYNGVAKECDPDGLEQDRHASRARA
HTIDTHLHSDSSHFYCESCQAKIRSRLASGTGGKPGSTRDNMVDLTSLPPPGNNDEEEDE
TTSLLPAIAAPPPGFRDNSSDEDDPKRRAAAQGQEQGRHLCGILYDEIPVTLIDSVQPRT
VRDHAQELDDALVSTLQALEALAASEDCPHPPPQQTAGLIVLAAITPESSLDSGHETNSS
ELTDVSEMVSAMKQHQNAAYFLTQHINKENLLARKDLPFRIQSCAAQAVLTSPYPLSRQD
PSPSLKPAFSTQNPSLPNCKSKQEQQHGEQSCTSAAQPGQTPQLSEQSKGASVPSSECKG
AGHTKAAFEVPLHATAAPSRERAQDLQEKMPKDPVHLQLLLDQKSSVTSAIVSAALQRGM
QLSPGLQQVAKAKASAPHVVSALKEQNMNGTSSCASASSKPLTLKGGPQTAETLCNFSLQ
QHCEVSPSPKEAPGSQAEAFHLASAGEEMMSSKTFASKSYQQKVSRDAPGKAASGETGQK
AGGEAISLVLQKHTAPSNQGQKIQQESSAKILKAESSNVHSPSPGSTFRSTSEEAKGPIQ
LMPRSESLQISTVPSKKVEKVLEVTQQDADVPAKPKAPKAPFRLRNLFSATFPTRLKKET
DERQAQLQKVKQYELEFLEELLKPKSKGDLPPQEYLHPPAPGRCSCQLRSSPVQKVPGMS
REQRRSCDCKRICRGMRPPPNQLMIPELERRGRDKDADDQKQVEAIRLTSLSSPSKGKRI
RSTSLESRDNRSDAEKDMSCLTTCTSRGECMSAPHYRKLLRRYSVSEIDKTDRTSLSSDV
YQNIYTTKQKGPQKEPEPSILCPVPKSKLQEASGVADPSYVQIAQDKKNQKGSAVFSVQE
EMYPSPAELQDEDMEDEKCCSIRYCFYYRKCDVADDGSEKDELSYSIPMQILPGMKL
Download sequence
Identical sequences H0Z7W6
ENSTGUP00000006666 ENSTGUP00000006666 59729.ENSTGUP00000006666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]