SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006882 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006882
Domain Number 1 Region: 93-193
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 2 Region: 23-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000143
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006882   Gene: ENSTGUG00000006700   Transcript: ENSTGUT00000006951
Sequence length 193
Comment pep:novel chromosome:taeGut3.2.4:3:26433935:26437457:-1 gene:ENSTGUG00000006700 transcript:ENSTGUT00000006951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YHPAPLSEKSPTDTFVVEVRALYKLPVYYSIASGDEKGYFIIHSSSGIVRTRKNLELEDF
PVNFKVRATDSSNAVIFNEVEVKVEVIDENNFPPVFPSSLLEERLPEHSPATQIVQLKAQ
DNDTGRNGFLTYGILNGHRLKFRINETTGILYSTAPFDYEEEPTEYQVVVYAEDDGIPEK
KRGYCTVVIKITD
Download sequence
Identical sequences H0Z8H9
59729.ENSTGUP00000006882 ENSTGUP00000006882 ENSTGUP00000006882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]