SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006986 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006986
Domain Number 1 Region: 188-255
Classification Level Classification E-value
Superfamily Homeodomain-like 3.64e-21
Family Homeodomain 0.0034
Further Details:      
 
Domain Number 2 Region: 75-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000234
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 44-72
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000303
Family LIM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006986   Gene: ENSTGUG00000006782   Transcript: ENSTGUT00000007055
Sequence length 341
Comment pep:novel chromosome:taeGut3.2.4:17:9945808:9958529:-1 gene:ENSTGUG00000006782 transcript:ENSTGUT00000007055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQPDGESSAWGALEKEDARSAPSTPTTPSVCSPPSSSSSTPSAGKNVCSSCGLEILDRYL
LKVNNLIWHVRCLECSVCRTSLRQQHSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASD
WVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGI
TLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRV
IQVWFQNCRARHKKHTPQHTVPPSGAPPSRIPSSLPDDIHYSPFSSPERARMVTLHGYIE
SQVQCGQVHCRLPYTAPPVHLKADMEGPLSNRGEKVILFQY
Download sequence
Identical sequences H0Z8T3
ENSTGUP00000006986 59729.ENSTGUP00000006986 ENSTGUP00000006986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]