SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007722 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007722
Domain Number 1 Region: 1080-1380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.75e-62
Family Tandem AAA-ATPase domain 0.0000429
Further Details:      
 
Domain Number 2 Region: 805-1078
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-59
Family Tandem AAA-ATPase domain 0.000064
Further Details:      
 
Domain Number 3 Region: 2543-2606
Classification Level Classification E-value
Superfamily BRK domain-like 6.8e-17
Family BRK domain-like 0.0000858
Further Details:      
 
Domain Number 4 Region: 2477-2548
Classification Level Classification E-value
Superfamily BRK domain-like 2.35e-16
Family BRK domain-like 0.00049
Further Details:      
 
Domain Number 5 Region: 683-746
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000022
Family Chromo domain 0.02
Further Details:      
 
Domain Number 6 Region: 758-823
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000011
Family Chromo domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007722   Gene: ENSTGUG00000007476   Transcript: ENSTGUT00000007803
Sequence length 2606
Comment pep:novel chromosome:taeGut3.2.4:11:8871500:8938497:-1 gene:ENSTGUG00000007476 transcript:ENSTGUT00000007803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPMMDFFDDANLFSETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQDAQ
NQQKMSEFDQLNQYDSLKLHSVNQSFNSSADNVLSPHSQFNCSPVHPQNQSNGMFPDVAD
GSPMWGHQTATTVSNQNGSPFHQGHSQSMQQNKSFVAHHDFALFQANEPQHQCASLRPQQ
SRNNTGQDALSQPKDFMEVNVSTSLRVSVNHPPSVSNPSTSQQPLSVQQFSQTASTSIHF
CGNQEGNFDGQSPTITPCSVSSSQQFSSPYSYSNNHISPTSLLQPTTGLSTSQQTHSISD
FTGSDAFTSQTGTKQETTEHMLNPNTALNSSTFQMLHSAHPQGNFSSSKLSPVNINFPAS
TGSASQISHFTDSIESNGFTSLDDNLLHQVETHNEPFTGLDPDDLLQEDLLPQFDDSAFV
QDSTSHVLEHDLEHHITPQQVTSSSELVRPPSQTQIHPWHSSVSNQHLQGRSRATLQGQP
PSKKTDGSGSYTKLQNTQVRGMSEKKQKKKTDSESKQEKANRIISEAIAKAKERGERNIP
RVMSPENFPSVSAEGKEEKKGRKVKSKPKDKETKKPKTGSSSKIKEKTKIGKLIITLGKK
QKRKNESSDELSDAKQTPQRPLKDEDSQKRRSNRQVKRKKYSEEGEGKQSEEEAAKVSVK
IKKNSAPLPAEQPLQLFVENPSEEDAAIVDKILSSRVIKKEISAGMTVDTEEFFVKYKNY
SYLHCEWATEQQLLKDKRIQQKIKRFKVRKAQRAHFFADMEEEPFNPDYVEVDRVLEVSL
CEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDQAKIEEFEQLQASRPDSRRLDRPPPN
SWKKIEQSREYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEIL
LTGIRGPFLIIAPLSTITNWEREFRTWTDLNVVVYHGSMISRQMIQQYEMYFRDSQGRIV
RGTYRFQAIITTFEMILGGCPELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVL
LTGTPLQNTVEELFSLLHFLEPLRFPAESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLK
EDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFAFLSKGAGQANVPNLVNTMMELRKC
CNHPYLIKGAEEKILGEFKETYNPSAPDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLI
FSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGL
GINLTAADTCIIFDSDWNPQNDLQKAQARCHRIGQNKAVKVYRLITRNSYEREMFDRASL
KLGLDKAVLQSMSGRENSVGGIQQLSKKEIEDLLRRGAYGAIMDEEDEGSKFCEEDIDQI
LQRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIDAISGRNS
LVIDTPRIRKQTRPFSATKDELAELSEVESEGEEKPKLRRPCDRSNGYGRTECFRVEKNL
LVYGWGRWREILSHGRFKRQLNEQDVEIICRALLAYCLVHYRGDEKIKSFIWDLITPTED
GQTRELQNHLGLSAPVPRGRKGKKVKTQASTFDIHKAEWLRKYNPEHLLQDEGYKKHIKH
HCNKVLLRVRMLYYLKQEVIGNEFQKVFDGTDASEIDVWVPEPDHSEVPAEWWDADADKS
LLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDYMDGDVEDPEYKPAPA
LFKDDIEDDVSSPGDLVIADGDGQMMEGDKIYWPTQSALTTRLRRLITAYQRTSKNRQAQ
QIQPTFPVQTSMMQLQYEEAALNPKMAAKIERQQRWTRREEADFYRVVSTFGVVFDPERG
RFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVCRLPSKEELVDPNLFIQPITEERAS
RTLYRIELLRKVREQALRHPQLFERLKLCQPNPDLPVWWECGTHDRDLLIGAAKHGVSRT
DYHILRDPELSFMSAQRNYNQNKAVLSRTSTPLLHQYQMALSASPLTPQSRLSDAKVNAF
EDTKAKNENMKEDPQSSEEESMSTEETQTILKSEPLSPKNGTPMQITDHRPSVKAETDRR
MVAARTEPLTPNPASKKQRVSKRGSDSSSDSDSDSDRSSCSSRSSSSSSSSSSSCSHSRS
GSSSSSSSSCSSASSSSSSSSSSSSSSSSSSSEESDSDEEEAQKRAEGTPHIKAYDEESV
ASLSTTQDETQDSFQMNNGTPNSGYLLQGGYMLAASYWPKDRVMINRLDSICQTVLKGKW
PSARRSYDSATVASFYTTKLLDSSGAAAEYSEPSAPTPPLAAVKEEYDQSPQLSKVKKHV
REKEFTVKINDEGGLKLTFQKQGLSQKRPFESEEGALGQQQYLARLRELQNASETSLVNF
PKSLPKSGTSSHLTASANGVIVDSQPVVKKRRGRRKNVEGVDVLFMNRSKQPNHVNPGIN
SCQVAAGINPALTYTQSQGMLDAESPVPVINLKDGTRLAGDDAPKRKDLERWLKEHPGYV
EDSGACIPRMQLHDGRPKQKRHRCRNPNKLDVNSLTGEERVQLINRRNARKVGGAFAPPL
KDLCRFLKENPEYGVAPEWGEVVKQS
Download sequence
Identical sequences H0ZAW5
ENSTGUP00000007722 ENSTGUP00000007722 59729.ENSTGUP00000007722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]