SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007965 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007965
Domain Number 1 Region: 972-1041
Classification Level Classification E-value
Superfamily UBA-like 6.24e-16
Family UBA domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 1530-1627
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000115
Family Canonical RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007965   Gene: ENSTGUG00000007733   Transcript: ENSTGUT00000008050
Sequence length 1733
Comment pep:novel chromosome:taeGut3.2.4:18:7408508:7447283:1 gene:ENSTGUG00000007733 transcript:ENSTGUT00000008050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEGNCSWDKVIIDRTDKEAWPSITGAETESASECTTDTDSASNCGSENSSMATGSAQGNF
TGHTKKTNGNNGANGALVQSTSNQSALGAGGANGNGGSARVWGVAAGSSSGLAHCSASGG
DGKMDNMMGDGRSQNCWGASNSNAGINLNLNPNANPAAWPVLGHEGTVGAGNPSSICSPV
SAIGQNMGNQNGNPTGTLGAWGNLLPQESTEPQTSTSQNVSFSVQPQNLNTDGPNNTNPM
NSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGTAVSQVSGGSGEGMGSSVWG
MSPGNPAAGNSNSGFSQGNGDTVNSALSAKQNGSSSAVQKEGNGANAWDSGPPSGPGVLA
WGRGGGGVGSVHSGAWGHPNRSASNGVNGEWGKPPNQHSNSDINGKGSTGWDSSSVTSPN
PAMQQGNEQMNSWAKAAASGTTASEGSNDSGGSQNEGSTGREGAGEGRRRDKGMIDQGQV
QLPRNDLDPRVLSNTGWGQTPVKQNTAWEFEESPRSERKNDNGTEAWGCAATQSSNSGGK
NDGSIMNSTNTSSVSGWVNSPPAAVPTNTGWGDNNNKAPNGPGGWGESASSTTVNNAAAA
KSGHAWSGTANQEDKSPTWGEPQKPKSQNWGDGQKSNPSWTSGGGDWTDSSSVPGHLGDG
KKNGSGWDSDNRSGSGWNDSTKSGTSGWGNGTNSKANTGTSWGESLKPGPQQNWANKPQD
NNVSHWGGAASVKQTGSGWVGGPVPAKQKENCEATGWEEPSPPSIRRKMEIDDGTSAWGD
PNYNNNKTVNMWDRNNPIIQSSTTTNTTTTSTIINSNMAEPQPSHQSSAQPNRSPLLGPG
MTTAAGWGEMPAVHTKSEASWGEPSSPSAAVDNGTSAWGKPPSSGTGWGENPAEPAGTYG
RTNAPAAAPALCKPASKSMQEGWGSGGDEVNLSTSQWEDEEGDMWNNTASQESSSSCNSW
GNAPKKGLQKGMKTSSKQDEAWIMNRLIKQLTDMGFPREPAEEALKSNSMNLDQAMSALL
EKKVEMDKRGMGVTDYNGMVTKPLGCRPPPISKESSMDRPTFLDKDGGLVEEPTTSPFLP
SPSLKLPLSNSALPNQTLGGIASGLGMQNLNSSRQIPSGNLGMFGNSGAAQARTMQQPQQ
PPVQPLNSSQPSLRAQVPQFLSPQVQAQLLQFAAKNIGLSPAQLTSPINNPQHMTMLNQL
YQLQLAYQRLQIQQQMLQAQRNVSGPMRQQEQQVARTINNMQQQIQQHQRQLAQALLMKQ
QPPPPHLSLHPSAGKSAMDSFSPHPQAPGLPDLQTKEQQSSPNTFAPYPLAGLNPNMNVN
NMDITGGLSVKDTSQSQSRLPQWTHPNSMDNLSSAASSLDQNSSKHGAIPGGLSIGPPGK
SSLDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKISNGSSINWPPEFHPGVPWKG
LQNIDPENDPDVTPGSVPTGPTINTTIQDVNRYLLKSGGKLSDIKSTWSSGPISHTQASL
SHELWKVPRNTTAPTRPPPGLTNTKPSSTWGASPLGWTSSYSSGSAWSTDSSGRTSSWLV
LRNLTPQIDGSTLRTLCLQHGPLITFHLNLTQGNAVVRYSSKEEAAKAQKSLHMCVLGNT
TILAEFAGEEEVNRFLAQGQALPPTSSWQSNTGSTPSRLGSSGSSHGLVRPDAGHWNPPC
LGGKGSSDLLWGGVPQYSSSLWGPPSADDGRVIGSPTPLNTLLPGDLLSGESI
Download sequence
Identical sequences H0ZBK7
ENSTGUP00000007965 59729.ENSTGUP00000007965 ENSTGUP00000007965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]