SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008341 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008341
Domain Number 1 Region: 435-542
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-29
Family Second domain of FERM 0.00058
Further Details:      
 
Domain Number 2 Region: 543-654
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-28
Family Third domain of FERM 0.0046
Further Details:      
 
Domain Number 3 Region: 341-432
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.28e-18
Family First domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008341
Domain Number - Region: 13-161
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00149
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008341   Gene: ENSTGUG00000008093   Transcript: ENSTGUT00000008428
Sequence length 711
Comment pep:novel chromosome:taeGut3.2.4:6:17260371:17282529:-1 gene:ENSTGUG00000008093 transcript:ENSTGUT00000008428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPVSTASGMSNSCVTLAEVLWAKGSPLEEEEIWALLYLSTVQLLEDLHKDPAICVICPWS
VLLSAEGNLFFQSNASQTEAAPFSPPELLHRPSKNQHFGLTKMLVYSLGMTLYWSADYQV
PPNQATQLSDQLHALLLTLCEDLPHRRLSPESILEACEAHQKESASLPAKFYIKKMVQFA
VGSVSEVKQVVTEDSAASQLSRSHVIRKRLHENISDTSTLASQMNFHQARTQERRLPTHG
SCDTTLSGSRTQSSYKLFINSVAMPPYLDPGEPTEERHQTERSHQSAFAPYSTLKSIRSS
IQQYKLFSGPEFIILSSEPPVTLQLPGSIVTKKGKSYLSQRDLNVILLNGQCLEVQCDIK
TKARDVFNTVVAYANLVEHFYFGLAYLKGKEFFFLDEETKLYKVAPDGWNDQPKKKMSII
NFTLFLRIKFFVNHFNVIQHGLTRHQFYLQLRKDILEERLYCSDETALKLGALALQAELG
NYASEQRTSVNYFRVEDYVPASRIEKMTLAYVQRELAKLHRMNRSLFEDEAELEFLKVTQ
QLPEYGVLFYRVSQEKKGTEGDIILGICAKGIIVYENKNQTRIASLRFQWRETERISAHR
KKFMIESSFSGKKHTFITDTAKTCKYLLDLCSAQHKFNAQMNSRQLRQTSSEDSKFVEID
KSNPAYAAQHEHLALIQRLSRSENVLYGANLENLSAGMMSKSCDNLSVETS
Download sequence
Identical sequences H0ZCN0
59729.ENSTGUP00000008341 ENSTGUP00000008341 ENSTGUP00000008341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]