SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008492 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008492
Domain Number 1 Region: 420-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-24
Family SPRY domain 0.0043
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-16
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 160-217
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000504
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008492
Domain Number - Region: 207-275
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0129
Family Sec2 N-terminal region 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008492   Gene: ENSTGUG00000008241   Transcript: ENSTGUT00000008583
Sequence length 621
Comment pep:novel chromosome:taeGut3.2.4:18:8225876:8232550:1 gene:ENSTGUG00000008241 transcript:ENSTGUT00000008583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEGPLGCPICLDVLRDPVTVPCGHNFCQGCLQELRQRPGPPDGGGAGGAARCPLCQEPVP
AALRLCKNRALCELLPLLAAATGASSPSPSAAASPTSPMAPGAEEEDAAGEEGGAVVLCD
VCPPESRGAAERSCLVCLASFCGAHLEPHRRAPAFRAHRLVAPLRRLEEGLCPRHLQPLD
GFCRTEQSCVCARCRAHEHRAHDVVPLAEREHKQAQQAKFLSDAENELQELAVTITQAKK
MVELIKGAATKERERVEKLFAEASEVLAAFQKEVTGFIEDEERSMLGEAEADLRWKEQRR
AKLAQCKQSLENVPSTDTIYFLQEFQALKAAMEENLSPPLSFQKELNFTKCTQAVGAMKD
VLSTACKNQWNHLQGKGIDGFNCQEMEEGNSSSQDRQTSSRGRLWAPKHARLPIAFIIDL
DSDTADKFIQLFGTKGAKRVLCPIPYPESPTRFINCEQVLGLNLMNRGNYYWEVELIDGW
VSIGVIAEDFDPREAYNHGRLGRNDRSCCLQWNGQNYVAWFGGFECAIHQPFFHTIGVFL
EYSEKALTFYGVKDSKMTCLQQLKVSPSAKGKLDPFQNKINRQFASLFSCKLKPAFFLES
VDAHLQIGPLKRDCVSVLKRR
Download sequence
Identical sequences H0ZD31
59729.ENSTGUP00000008492 ENSTGUP00000008492 ENSTGUP00000008492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]