SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008526 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008526
Domain Number 1 Region: 325-488,527-691
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.42e-71
Family YicI catalytic domain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 81-322
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-42
Family YicI N-terminal domain-like 0.0056
Further Details:      
 
Domain Number 3 Region: 694-772
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.01e-20
Family Putative glucosidase YicI, domain 3 0.0095
Further Details:      
 
Domain Number 4 Region: 50-111
Classification Level Classification E-value
Superfamily Trefoil 0.00000000000366
Family Trefoil 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008526   Gene: ENSTGUG00000008237   Transcript: ENSTGUT00000008617
Sequence length 905
Comment pep:novel chromosome:taeGut3.2.4:14:13197828:13207044:1 gene:ENSTGUG00000008237 transcript:ENSTGUT00000008617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEGAAPMPSSHGKLAPWWVGSGLLVAAVLLSTITVWVLRQVSGGWLGPTPPPKCLLVPE
SHRFDCYPERHVVVTQELCESRGCCFIQSPPLAEGKQGVPWCFYPPDFPSYTLESLNQTA
LGMVGLLVRREKAYYPRDIEKLRLDVEFETDTRLHIKITDAANPRYEVPLDVPRVMKRAE
NPIYSLNFSWDPFGVLLQRKATGTVLLNTTVAPLIFADQFLQISTSLPSKFLYGLGEHRG
SLLHSLDWNTLTLWARDVPPTESLNLYGAHPFYLLIEEGGNAHGVFLLNSNAMEVALQPA
PGLTWRTIGGVLDFYIFLGPNPNMVIQQYQQVIGFPAMPPIWALGFHLCRWGYGSSNETW
QTVRAMRNYQIPQDGQWNDIDYMDGYRDFTVDSQKFASLPSLVEDLHKHGQHYVMILDPG
ISSTSPQGSYWPFDEGLRRGLFLNTTQGKPLIGQVWGFTAFADFSNPGTHWWLELQHFHH
VPFDALIVYMGKASSVMEGSVVMYPPGEKDNPPYTPAVLGDSLSAKTVCASARQKVSVHY
NLHNLYGLMEAKATASALIKIRGKRPFVISRSTFPSQGRYSGHWLGDNRSQWKDMSYSIP
GLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFYPFARNHNTQNEKAQEPAVFSP
AARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARPLFFEFPWDVATWELDRQFLWGRS
LLVTPVLEPGVDSVTGYVPQGTWYDFYTGSSVNSSGEMLKMSAPLEHLNLHIWEGSILPT
QKPGTTTELTRGNPLRLIVALSSHATAWGDLFWDDGESLDTFEKGNYSYVVFNVTENIFT
STVLHASTEATKVTVGTLSIFGVQKPPSKVLLNGREKPFSYLDNQVLTVSDLGMSLSQGF
SLQWL
Download sequence
Identical sequences H0ZD65
ENSTGUP00000008526 ENSTGUP00000008526 59729.ENSTGUP00000008526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]