SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008541 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008541
Domain Number 1 Region: 92-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000013
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 30-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000202
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 3 Region: 163-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000393
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 177-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000213
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008541
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000114
Family Plant C2H2 finger (QALGGH zinc finger) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008541   Gene: ENSTGUG00000008275   Transcript: ENSTGUT00000008632
Sequence length 234
Comment pep:novel chromosome:taeGut3.2.4:20:12851742:12856852:1 gene:ENSTGUG00000008275 transcript:ENSTGUT00000008632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTSAKLSSRRCHLRSHSDEKRHTCHLCPKAFHTAALLHNHVNAHTGNKPHKCSECDAAFV
TRGELSRHRRYKHTLEKPFKCTICEYSSVEASKMRRHVRSHTGERPYPCHLCSYASKDAY
QLKRHMLTHTGEKRYECYICQARFTQSGTMKIHVLQKHGENVPKHQCPHCSTFLSRKRDL
GVHLRNLHSYMEEAVKCRDCGAAFHERYAFLQHRRTHRSEERFRCAQCSCTCNQ
Download sequence
Identical sequences H0ZD80
ENSTGUP00000008541 59729.ENSTGUP00000008541 ENSTGUP00000008541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]