SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009167 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009167
Domain Number 1 Region: 630-825
Classification Level Classification E-value
Superfamily Sec7 domain 1.05e-72
Family Sec7 domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 424-575,1084-1485,1643-1750
Classification Level Classification E-value
Superfamily ARM repeat 1e-26
Family Armadillo repeat 0.081
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009167
Domain Number - Region: 74-200,399-504
Classification Level Classification E-value
Superfamily ARM repeat 0.000297
Family GUN4-associated domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009167   Gene: ENSTGUG00000008857   Transcript: ENSTGUT00000009266
Sequence length 1780
Comment pep:novel chromosome:taeGut3.2.4:20:15312256:15343827:-1 gene:ENSTGUG00000008857 transcript:ENSTGUT00000009266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDARTKSMFVSRALEKILAEKEAKRPPHGQLRTACQVALDEIKTELEKQREGTAAPPKAN
FIEADKYFLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVET
ICNCFQGPQTDEGVQLQIIKALLTAVTSPYIEIHEGTILQTVRTCYNIYLASKNLINQTT
AKATLTQMLNVIFTRMENQALQESREAERAQKPQSPAVAGSRSPRPGQRQHSSWGDRAGT
ASSVLANGEPGPGEPDGLTGSIGSPQKERKGVVMETIDGGKEMVQGILEDVVESAVKGTS
QSHGVTEPVKALPVLEAADTLLSGSSNENVQTNGVPDDGQSVSSTDNLESDVSGHQAAAR
FSHVLQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLSVLQNAGLVFRTH
EMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKTHLKMQIEVFFKEIFLNI
LETSSSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRS
GHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGSYKPSEQEMAEGK
CLDTGGRRSSVSSLDSTVSVGTQTAVPDDPEQFEVIKQQKEIIEHGIELFNKKPKRGIQY
LQEQGMLGTTTEDLAQFLHQEERLCSTQVGEFLGESSKFNKEVMYAYVDQLDFCGKDFVS
ALRIFLEGFRLPGEAQKIDRLMEKFAARYIECNQRQTLFASADTAYVLAYSIIMLTTDLH
SPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSTIYEEIEGKKIAMKETKEYAITTKCSKP
SVANEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTPLLAA
YSVGLQNCDDPEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSITEMK
QKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGSGREREGS
IKGYASAEEFMSLGLGNLVGSGADKRHMASIQESVGETSSQSVVVAVDRIFTGSTRLDGN
AIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVIGDHFNKV
GCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIR
CIAQMVNSQAGNIRSGWKNIFAVFHQAASDHDGNIVELAFQTTAHIVTNIFQQHFPAAID
SFQDAVKCLSEFACNVAFPDTSMEAIRLIRYCAKYVSERPQVLREYTSDDMNVAPGDRVW
VRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVFRIFDNM
KLPEQQTEKSEWMTTTCNHALYAICDVFTQFYEALHEILLPDILAQLHWCVKQDNEQLAR
SGTNCLENLVILNGQKFSPDVWGQTCNCMLEIFKTTIPHVLLTWKPVGMEEDSSEKHLDL
DLDHQSLSSMDKNASERGQSQYSNPTDESWKGGPYTNQKLFAGLLIKCVVQLELIQTIDN
IVFYPATSKKEDAEHMAAAQRDTLDAVIHIDTEDQGMYKYMSSHHLFKLLDCLQESHSFS
KAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDESRREAWDAVQRR
LLSVCSEALAYFITVNSESHREAWTNLLLLLLTKTLKISDEKFRAHASAYYPYLCEIMQF
DLIPELRAVLRRFFLRIGAVFDICAAGEPARAAGTTLPSW
Download sequence
Identical sequences H0ZF05
59729.ENSTGUP00000009167 ENSTGUP00000009167 ENSTGUP00000009167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]