SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009184 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009184
Domain Number 1 Region: 104-266
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-19
Family C-type lectin domain 0.0061
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000101
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009184
Domain Number - Region: 265-330
Classification Level Classification E-value
Superfamily FnI-like domain 0.00046
Family VWC domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009184   Gene: ENSTGUG00000008905   Transcript: ENSTGUT00000009283
Sequence length 460
Comment pep:novel chromosome:taeGut3.2.4:15:8956552:8995087:1 gene:ENSTGUG00000008905 transcript:ENSTGUT00000009283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKADSGTFLLLFLLVLSITEPLRPELRCTPGQFACRSGTIQCIPSNWQCDGWPTCEDD
SDEVDCPVLTGDQRTYHGKENVDSRHSRGRGGETTRFHTVNVAQPVRFSSKVGKCPTGWH
HYEGTASCYRVYLNGENYWDAVQTCQRVNGSLATFTADQELRFILAQEWDLEEKTFVRKD
QRRFWVGYQYVITNRNHSLEGHWEVAYKGSSEVFLPPDPIFGSAMAEKENVLCAQLQYFH
FPTLRRHGLHSWYAENCYEKSSFLCKRSQTCVDIKDNIVDEGYYFTPKGNDPCLSCTCHN
GEPEMCVAALCERPQGCQQYLKDPKECCKFTCLDPDGNSLFDSMAGGMRLIVSCISSFLI
LSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRMPGFDYGPDGFGTGLTPLHLSDDGE
GGAFHFHDPPPPYTAYKYPDIQHPDDPPPPYEASVNPDSI
Download sequence
Identical sequences H0ZF22
ENSTGUP00000009184 ENSTGUP00000009184 59729.ENSTGUP00000009184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]