SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009536 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009536
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000024
Family TAP-C domain-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009536
Domain Number - Region: 51-176
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.00811
Family Tex N-terminal region-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009536   Gene: ENSTGUG00000009237   Transcript: ENSTGUT00000009637
Sequence length 258
Comment pep:novel chromosome:taeGut3.2.4:1:26184610:26202767:-1 gene:ENSTGUG00000009237 transcript:ENSTGUT00000009637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKLKSSQKDKVRQFMAFTQAGERTAIYCLTQNEWKLEVATDNYFQNPDLYYKESMKNSVD
KKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLSLDPASISVLVVAWKFRAATQCEFSKKE
FIDGMTELGCDTTEKLKALLPRLEQELKDPAKFKDFYQFTFNFAKNPGQKGLDLEMAIAY
WNLVLSGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFGNMIADDMSNYDEEGAWPVLID
DFVEYARPVITGGKHKTS
Download sequence
Identical sequences H0ZG24
ENSTGUP00000009536 59729.ENSTGUP00000009536 ENSTGUP00000009536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]