SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009572 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009572
Domain Number 1 Region: 413-675
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-56
Family YWTD domain 0.0000000212
Further Details:      
 
Domain Number 2 Region: 303-406,676-727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000107
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 208-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 4 Region: 125-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 244-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00039
Further Details:      
 
Domain Number 6 Region: 160-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.00046
Further Details:      
 
Domain Number 7 Region: 4-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 8 Region: 44-87
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 9 Region: 79-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009572   Gene: ENSTGUG00000009223   Transcript: ENSTGUT00000009674
Sequence length 896
Comment pep:novel chromosome:taeGut3.2.4:8:22247885:22431462:-1 gene:ENSTGUG00000009223 transcript:ENSTGUT00000009674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVKECEENQFQCRNERCIPAIWKCDEDDDCSDNSDEADCPKKTCAESDFTCDNGHCIPA
RWKCDGEEECPDGSDESEAACTKQVCPSEKISCGDLSNKCIPLSWRCDGQKDCESGIDEA
GCTPACSPNEFQCSNKSCISIIFVCDGDNDCGDGSDERKCSPLTCNPSEFQCNNSVCIPE
LWVCDNQPDCEDQSDESVEKCGYDAKALNTCAAHEFQCGNGECIHLNWKCDGDEDCKDKS
DEQDCPLVTCQPDEFQCGDGACIHGAKQCDKVRDCPDNSDEAGCVQESACESPSKFQCKS
GECIDGGKVCDSHRDCRDWSDEPLKDCGVNECSMNNGGCSHICKDLKIGYECECPPGYKL
LDKKTCGDIDECENPDACSQICINYKGDYKCECYEGYEMDTLSKNCKAVGKSPYLIFTNR
HEVRKIDLVKRDYSRIIPMLKNVVALDVEVSTNRIYWCDLFYRKIYSAYIDKASDTAEQV
ILIDSQLNSPEGLAIDWVHKNIYWTDSGNKTISVATADGSRRRTLFNSDLSEPRAIAVDP
TQRFMYWSDWGDKARIEKAGLNGVGRQVLVTDNIEWPNGITLDLLNQRLYWVDSKLHSLS
CIDFNGSNRKVLISSVDDLSHPFGLAVFEDRVFWTDLENEAIFSANRLNGLDISILAENL
NNPHDIVVFHELKQPKAPDSCELSPQPNGGCDYLCLPAPQISPHSPKYTCACPDNMWLGP
DMKKCYKDLPTTASPAVVSTTTASRADGTTTIAAGPGSANDTTEVVPKAVPEATITTPSH
LPSTTSILIDSEMTTGNSNLSQHYANDDEGFGSTVTAAVIGIVIPVVVIGLLCMGGYLIW
RNWKRKNTKSMNFDNPVYRKTTEEEDEDEIHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences H0ZG60
59729.ENSTGUP00000009572 ENSTGUP00000009572 ENSTGUP00000009572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]