SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009952 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009952
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.57e-35
Family CAD domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009952   Gene: ENSTGUG00000009653   Transcript: ENSTGUT00000010059
Sequence length 182
Comment pep:novel chromosome:taeGut3.2.4:2:102664602:102671320:-1 gene:ENSTGUG00000009653 transcript:ENSTGUT00000010059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGAVTRQTLFPPLMPAGRPFRVSNASRSSRKGIVASSLQELLSKTLDAFFITAGIVTLVL
EEDGTVVDTEDFFKSLDDNTHFMVLENGQKWTPVSQWMEECLKKKKMGVANITFDLYKLN
PKDFIGCLNIKATFYEIYSISYDIKCMGAKSVLRKVIQLISHAAQITGQFLLYTGTYMLQ
LL
Download sequence
Identical sequences H0ZH87
ENSTGUP00000009952 ENSTGUP00000009952 59729.ENSTGUP00000009952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]