SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010913 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010913
Domain Number 1 Region: 174-351
Classification Level Classification E-value
Superfamily MIR domain 1.05e-50
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1038-1163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-17
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 3952-4030
Classification Level Classification E-value
Superfamily EF-hand 0.000000000226
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 4 Region: 616-750
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000348
Family SPRY domain 0.058
Further Details:      
 
Domain Number 5 Region: 56-139
Classification Level Classification E-value
Superfamily MIR domain 0.00000327
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 380-505
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000549
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 7 Region: 1369-1490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000135
Family SPRY domain 0.022
Further Details:      
 
Domain Number 8 Region: 2103-2169
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000902
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010913   Gene: ENSTGUG00000010491   Transcript: ENSTGUT00000011027
Sequence length 4912
Comment pep:novel chromosome:taeGut3.2.4:3:45536303:45794771:1 gene:ENSTGUG00000010491 transcript:ENSTGUT00000011027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVPPDLSICTFVLEQSLSVRALQEMLANTEEKAEGQDNTESWQLSTKSAQGGGHRTLLYG
HAILLRHSYSGMYLCCLSTSRSSMDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVR
VGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEVAQGYLIGGDVLRL
LHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSIHARSLWRLETLRVAWSGSHIRWGQPFR
LRHITTGKYLSLLDDKSLLLTDKEKADVKSTAFCFRSSKEKLDIGTRKEVDGMGAPEIKY
GDSICFIQHVDTGLWLTYQSADAKSVRMGSLQRKAIMHHEGHMDDGLTLSRSQNEESRTA
RVIRSTVFLFNRFIRGLDVLSKKVKSSTIDLPIESVSLSLQDLIGYFHPPDEHLEHENKQ
NRLRALKNRQNLFQEEGMINLVLECIDRLNVYSSAAHFADVAGKEAGEAWKSILNSLYEL
LAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKS
IICLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMR
PNIFLGISEGSAQYRKWYYELMVDHLEPFVTAESTHLRVGWASTEGYSPYPGGGAEWGGN
GVGDDLYSYGFDGLHLWSGCVARTVNSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQ
GMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCFEAVLPKEKLKVEN
SREYKQDRSYTRDLLGPTVSLSQAAFTPVPVDTSQIVLPPHLERIREKLAENIHELWVMN
KIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIADER
AEEKVKKMKLPKNYQLLSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGW
TYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHATRLD
VCSGIMEKFRIFRTEKTYAVKAGKWYFEFEAVTAGDMRVGWTRPGCLPDQELGSDEEAFV
FDGFKAQRWHQGNEHFGRSWLAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFE
VADGFLPVCSLGPSQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITIWWSKRLP
QFLPVPQNHEHIEVMRIDGTIDSCPCLKVTQKSFGSQNSKTDVMFFRLSMPIECAEVFSR
SAAGGLPGSGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRTEREKDATKPELNNHKDY
VQEKPSRLKQRFMLRRTKPDYSMSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQ
EPANVWVGWITSDFHQYDTSFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESLSP
GQGRNNNGLEIGCLVDAASGLLTFTANGKELGTYYQVEPSTKLFPAVFAQATSPNVFQFE
LGRIKNVMPLSAGLFKSEHKNPISQCPPRLHVQFLTHVLWSRVPNHFLKVDVSRISERQG
WMIQCLNPLQFMALHIPEENRTIDILELTEQEELLKFHYHTLRLYSAVCALGNNRVAHAL
CSHVDESQLLYAIENKYMPGLLRAGYYDLLIDIHLNTYATARLMMNNEFIVPMTDETKSI
TLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSISSECFQFSPEFPLEILKAKTIEMLT
EAVQEGSLHVRDPVGGSTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPRVFKEAMS
QEDEIDFSEKEFSSDELKSEEGEEETRGEQMPKEGLLQMKLPEPVKLQMCHLLQYLCDCQ
VRHRIEAIVAFSDDFVAKLQENQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLL
NFKDDKNDCPCPEEIRDQLLDFHEDLMTHCGIELDEDGALDGNSDSTIRGRLLYLMEKVT
YLKKKQDEKTVDEDDKTSSTLQQLISDTMVRWAQESVIEDPELVRAMFVLLHRQYDGIGG
LVRALPKTYTINSVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQ
HPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDH
LSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSC
PLLICKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRG
EGGNGLLAAMEEAIQISEDRTRDGPSPSNGSSKTLEIEEQEDDTIHMGNAIMTFYAALID
LLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLEDLVGVISIAFHMPTIAKDGTVVEPDMS
AGFCPDHKAAMVLFLDRVYGIEDQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALN
RYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEECLLSIC
GQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPSGWGNFGAASEEE
LHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVNMMEKQSSMDS
DGNFNPQPVDTSNITIPEKLEYFINKYAEHAHDKWSMEKFANGWTYGETFSESAKVQPLM
KQYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQISVDT
AHGYTPRAIDMSNVTLSRDVHAMAEMMAENYHNIWAKKKKLELEAKGGGNHPLLVPYDTL
TAKEKAKDREKAQDILKFLQINGYVVSRGLKDLELDTPSIEKRFAYSFLQQLIRYVDEAH
QYILEFDGGSRGKGEQFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSSASRPLSSGGHAS
NKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVRMAL
RTFLDNAAEDLEKTMENLKQGQFTHSRNQPKGVTQIINYTTVALLPVLSSLFEHIGQHQF
GEDLILEDVQVSCYRILASLYALGTSKSIYVERQRSALGECLAAFSGAFPVAFLETHLNK
HNIYSIYNTKNARDRAVLNLPTSVEKVCPNIPSLMKLMEEIVELAESGIRYTQMPHIMEV
ILPMLCSYMSHWWEHGPENNPDKAEMCCTALTSEHMNTLLGNILKIIYNNLGIDEGAWMK
RLAVFSQPIISKAKPQLLKTHFLPLMDKLKKKAAVVVSDEEHLRAEGRGDMSEAELLILD
EFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQ
NFVVQNEINNMSFLISDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIG
LNICAPGDQELIALAKNRFSMKDTEDEVRDVIRSNLHLQGKLEDPAIRWQMALYKDLPNR
TEDSSDPEKTVERVLDIANVLFHLEQSCSFLKLFYVNSVEHPQRSKKAVWHKLLSKQRKR
AVVACFRMAPLYNLPRHRAVNLFLQGYDKSWIETEEHYFEDKLIEDLAKPGEEPPEEDES
LKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEK
EMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGPMVAATLKLGIAILNGGNSTVQQKM
LDYLKDKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVMQDDEFTC
DLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDV
IDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMK
LSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFF
DMFLKLKDLTSSDAFKEYDPDGKGIISKRDFHRAMESHKHYTQSETEFLLSCAETDENET
LDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPHDTRLQTFLELSESVLNYFQPFLGRIE
IMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTI
FEMQLAAQISESDLNERSANKEENDKDNPEEEDPRMGFFSLVTMKSALVALKYNLMTLMK
MLSMKSLKKQMKKMKKMTMKDMVLALFSSYWSILVGLLHFACSVVRGFFRIICSLLLGGS
LVEGAKKIKVAELLANMPDPTQDEVRGEEEEGERKPTEAALPAEDLTDLQTLTEESDLLS
DIFGLDLKREGGQYKLIPHNPNAGLSDLLSTPSLAPMPEVQENIQVIKVKEDEKEEKEET
KSEPEKAEGEDGEKEEKTKEDKGKQKLRQLHTHRYGEPEVQESVFWKNIIAYQQKLLNYF
ARNFYNMRMLALFVAFAINFILLFYKVSTSAVTEEKELPVVSDGESTKLNILESDDERVI
AVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGL
YITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKA
ALDFSDAREKKKPKKDSSFSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYN
NFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNK
SEDGDMPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVI
VILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNL
ANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences H0ZJZ3
ENSTGUP00000010913 ENSTGUP00000010913 59729.ENSTGUP00000010913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]