SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010918 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010918
Domain Number 1 Region: 345-605
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.45e-88
Family Eukaryotic proteases 0.0000000346
Further Details:      
 
Domain Number 2 Region: 104-194
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-30
Family Kringle modules 0.0000534
Further Details:      
 
Domain Number 3 Region: 204-289
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-24
Family Kringle modules 0.00029
Further Details:      
 
Domain Number 4 Region: 45-106
Classification Level Classification E-value
Superfamily GLA-domain 2.86e-20
Family GLA-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010918   Gene: ENSTGUG00000010580   Transcript: ENSTGUT00000011032
Sequence length 608
Comment pep:novel chromosome:taeGut3.2.4:5:22064020:22073583:-1 gene:ENSTGUG00000010580 transcript:ENSTGUT00000011032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQNKTRILRGLLFSSLLHLTLSHAGVFLEKRQALSLLKRHRRANKGFLEEMLKGNLERE
CLEETCSYEEAFEALESTDQTDIFWSKYQVCQGLGKSRTILDACLEGNCALGLGQNYQGT
ISQTKSGIECQVWTSKYPHIPKFNATIYPNLIENYCRNPDNNSEGPWCYTRNPTVEREAC
PIPVCGEDRTTVPFTPPAVEPAPMEPCEPEKGMLYTGTLSVTVSGAKCLPWNSEKAKEVL
HGKKIDPEVELQENYCRNPDRDDEGAWCVTDESPYFDYCDLHYCDSSLEDENQEFEGISG
RSTTHKEFKTFFDEKTFGSGEADCGTRPLFEKKKITDKSERELLDSYAGRVVGGDDAEVG
SSPWQVMLYKKSPQELLCGASLISDSWILTAAHCLFYPPWDKNLSTSDILVRIGKHVRAK
YEKNKEKIALLDKIIIHPKYNWKENMDRDIALMHLKRPISFSDYIHPVCLPTKEVVQRLM
LAGYKGRVTGWGNLKETWATSPSNLPTVLQQVNLPIVDQSTCKASTRVKVTDNMFCAGYS
PDALKRGDACEGDSGGPFVMKNPDDNRWYQVGIVSWGEGCDRDGKYGFYTHVFRLKKWIR
KVIENQGR
Download sequence
Identical sequences H0ZJZ8
ENSTGUP00000010918 ENSTGUP00000010918 XP_002198813.1.42559 59729.ENSTGUP00000010918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]